spacer

EBI Dbfetch

ID   HE793165; SV 1; linear; genomic DNA; STD; HUM; 3093 BP.
XX
AC   HE793165;
XX
DT   21-MAR-2012 (Rel. 112, Created)
DT   25-APR-2014 (Rel. 120, Last updated, Version 2)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*07-EC, exons
DE   1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3093
RA   Vilches C.;
RT   ;
RL   Submitted (14-MAR-2012) to the INSDC.
RL   Vilches C., Immunogenetics-HLA lab, H.U. Puerta de Hierro, Manuel de Falla
RL   1, 28222, SPAIN.
XX
RN   [2]
RX   DOI; 10.1111/tan.12192.
RX   PUBMED; 24033148.
RA   Cisneros E., Martinez-Pomar N., Vilches M., Martin P., de Pablo R.,
RA   Nunez Del Prado N., Nieto A., Matamoros N., Moraru M., Vilches C.;
RT   "Advancing allele group-specific amplification of the complete HLA-C
RT   gene--isolation of novel alleles from three allele groups (C*04, C*07 and
RT   C*08)";
RL   Tissue Antigens 82(4):280-285(2013).
XX
DR   MD5; e45eed48ec341cc12ae10b917381d885.
DR   Ensembl-Gn; ENSG00000233841; homo_sapiens.
DR   Ensembl-Tr; ENST00000424832; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3093
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..92,223..492,743..1018,1606..1881,2006..2125,
FT                   2566..2598,2706..2753,2918..>3093)
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT   exon            <1..92
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=1
FT   CDS             join(20..92,223..492,743..1018,1606..1881,2006..2125,
FT                   2566..2598,2706..2753,2918..2922)
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:O19617"
FT                   /db_xref="IMGT/HLA:C*07:01:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19617"
FT                   /protein_id="CCG58319.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   intron          93..222
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=1
FT   exon            223..492
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=2
FT   intron          493..742
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=2
FT   exon            743..1018
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=3
FT   intron          1019..1605
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=3
FT   exon            1606..1881
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=4
FT   intron          1882..2005
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=4
FT   exon            2006..2125
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=5
FT   intron          2126..2565
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=5
FT   exon            2566..2598
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=6
FT   intron          2599..2705
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=6
FT   exon            2706..2753
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=7
FT   intron          2754..2917
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=7
FT   exon            2918..>3093
FT                   /gene="HLA-C"
FT                   /allele="C*07-EC"
FT                   /number=8
XX
SQ   Sequence 3093 BP; 578 A; 901 C; 973 G; 641 T; 0 other;
     attctcccca gaggccgaga tgcgggtcat ggcgccccga gccctcctcc tgctgctctc        60
     gggaggcctg gccctgaccg agacctgggc ctgtgagtgc ggggttggga gggaagcggc       120
     ctctatggag aggagcgagg ggcccgcccg gcgagggcgc aggacccggg gagccgcgca       180
     gggaggtggg tcgggcgggt ctcagcccct cctcgccccc aggctcccac tccatgaggt       240
     atttcgacac cgccgtgtcc cggcccggcc gcggagagcc ccgcttcatc tcagtgggct       300
     acgtggacga cacgcagttc gtgcggttcg acagcgacgc cgcgagtccg agaggggagc       360
     cgcgggcgcc gtgggtggag caggaggggc cggagtattg ggaccgggag acacagaact       420
     acaagcgcca ggcacaggct gaccgagtga gcctgcggaa cctgcgcggc tactacaacc       480
     agagcgagga cggtgagtga ccccggcccg gggcgcaggt cacgacccct ccccatcccc       540
     cacggacggc ccgggtcgcc ccgagtctcc ccgtctgaga tccaccccaa ggtggatctg       600
     cggaacccgc ccagaccctc gaccggagag agccccagtc gcctttaccc ggtttcattt       660
     tcggtttagg ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg ggggactggg       720
     ctgaccgcgg gggcggggcc agggtctcac accctccaga ggatgtatgg ctgcgacctg       780
     gggcccgacg ggcgcctcct ccgcgggtat gaccagtccg cctacgacgg caaggattac       840
     atcgccctga acgaggacct gcgctcctgg accgccgcgg acaccgcggc tcagatcacc       900
     cagcgcaagt tggaggcggc ccgtgcggcg gagcagctga gagcctacct ggagggcacg       960
     tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca gcgcgcaggt      1020
     accaggggca gtggggagcc ttccccatct cctatagatc tcccgggatg gcctcccacg      1080
     aggaggggag gaaaatggga tcagcactgg aatatcgccc tcccttgaat ggagaatggc      1140
     atgagttttc ctgagtttcc tctgagggcc ccctctgctc tctaggacaa ttaagggatg      1200
     aagtctctga ggaaatggag gggaagacag tccctggaat actgatcagg ggtctccttt      1260
     gaccactttg accactgcag cagctgtggt caggctgctg acctttctct caggccttgt      1320
     tctctgcctc acactcaatg tgtctgaagg tttgattcca gcttttctga gtcctgcagc      1380
     ctccactcag gtcaggacca gaagtcgctg ttcctccctc agagactaga actttccaat      1440
     gaataggaga ttatcccagg tgcctgtgtc caggctggcg tctgggttct gtgccgcctt      1500
     ccccacccca ggtgtcctgt ccattctcag gatggtcaca tgggcgctgc tggagtgtcc      1560
     caagagagat gcaaagtgtc tgaattttct gactcttccc gtcagaaccc ccaaagacac      1620
     acgtgaccca ccaccccctc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1680
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag acccaggaca      1740
     ccgagcttgt ggagaccagg ccagcaggag atggaacctt ccagaagtgg gcagctgtgg      1800
     tggtgccttc tggacaagag cagagataca cgtgccatat gcagcacgag gggctgcaag      1860
     agcccctcac cctgagctgg ggtaaggagg ggaatggggg gtcacatctc ttatcagaga      1920
     aagcagaagt ccttctggag cccttcagcc gggtcagggc tgaggcttgg gggtcagggc      1980
     ccctcacctt ctcctccttt cccagagcca tcttcccagc ccaccatccc catcatgggc      2040
     atcgttgctg gcctggctgt cctggttgtc ctagctgtcc ttggagctgt ggtcaccgct      2100
     atgatgtgta ggaggaagag ctcaggtagg gaaggggtga agagcggggt ctgggttttc      2160
     ttgtcccact gggagtttca agccccaggt agaagtgtgc cccgccttgt tactggaagc      2220
     accatccaca catgggccat cccagcctgg gaccctgtgt gccagcactt actcttttgt      2280
     gaagcacatg tgacaatgaa ggacggatgt atcaccttga tgattatggt gttggggtcc      2340
     tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca      2400
     gttggtccag aacccacaac tgctttcccc atgtttcctg atcctgccct gggtctgcag      2460
     tcgtagttct ggaaacttct cttgggtcca agactaggag gttcccctaa gatcacatgg      2520
     ccctgcctcc tcccagtccc ctcatagggc attttcttcc cacaggtgga aaaggaggga      2580
     gctgctctca ggctgcgtgt aagtgatggc ggcgggcgtg tggaggagct cacctactcc      2640
     ataattcctc ttgtcccaca tctcctgcgg gctctgacca ggtctttttt tttgttctac      2700
     cccaggcagc aacagtgccc agggctctga tgagtctctc atcacttgta aaggtgagat      2760
     tctggggagc tgaagtggtc gggggtgggg cagagggaaa aggcctgggt aatggggatt      2820
     ctttgattgg gacgtttcga gtgtgtggtg ggccgttcag agtgtcatca cttaccatga      2880
     ctgacctgaa tttgttcatg actattgtgt tctgtagcct gagacagctg cctgtgtggg      2940
     actgagatgc aggatttctt cacacctctc ctttgtgact tcaagagcct ctggcatctc      3000
     tttctgcaaa ggcgtctgaa tgtgtctgcg ttcctgttag cataatgtga ggaggtggag      3060
     agacagccca cccccgtgtc caccgtgacc cct                                   3093
//


spacer
spacer