Dbfetch

ID   HE774681; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE774681;
XX
DT   10-MAY-2012 (Rel. 112, Created)
DT   10-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*14new, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wallis-Jones S.;
RT   ;
RL   Submitted (09-MAR-2012) to the INSDC.
RL   Anthony Nolan Trust, Routine Sequencing, NW3 2QG, London, UNITED KINGDOM.
XX
RN   [3]
RA   Edwards Z., Wallis-Jones S.;
RT   "Novel Homo sapiens antigen presentation molecule most similar to
RT   HLA-DRB1*14:11";
RL   Unpublished.
XX
DR   MD5; fd79b7b4068208fee439817ede15bdbf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I2G7Y7"
FT                   /db_xref="IMGT/HLA:DRB1*14:126:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I2G7Y7"
FT                   /protein_id="CCG52014.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 62 C; 101 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//