spacer

EBI Dbfetch

ID   HE687288; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HE687288;
XX
DT   04-MAY-2012 (Rel. 112, Created)
DT   04-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*13
DE   variant 40:01, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Yang E.;
RT   ;
RL   Submitted (01-MAR-2012) to the INSDC.
RL   Buddhist Tzu Chi General Hospital, Tzu Chi Stem Cells Center, 707 Section 3
RL   Chung Yang Road, Hualien 970, TAIWAN.
XX
RN   [2]
RA   Yang K.L.;
RT   "Discovery of a new HLA-B*13 gene in Taiwan";
RL   Unpublished.
XX
DR   MD5; eff6a902069ac680ee9f142721bd2c75.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13 variant 40:01"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I2G7Q4"
FT                   /db_xref="IMGT/HLA:B*13:02:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I2G7Q4"
FT                   /protein_id="CCG28421.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13 variant 40:01"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13 variant 40:01"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 174 C; 184 G; 75 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gctcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat accttgagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer