spacer

EBI Dbfetch

ID   HE654769; SV 1; linear; genomic DNA; STD; HUM; 271 BP.
XX
AC   HE654769;
XX
DT   11-MAR-2012 (Rel. 112, Created)
DT   03-SEP-2014 (Rel. 122, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   DRB1*15:87, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-271
RG   BGI HLA novel-allele working group
RA   ;
RT   ;
RL   Submitted (11-JAN-2012) to the INSDC.
RL   BGI, Main Building 9/F, Beishan Industrial Zone, Yantia, Shenzhen 518083,
RL   CHINA.
XX
RN   [2]
RX   DOI; 10.1111/tan.12167.
RX   PUBMED; 23826662.
RA   Zhang C., Wang Y., Huang C., Zhang M., Chen C., Cao H., Chai X., Li J.;
RT   "Characterization of 27 novel HLA class II alleles from China marrow donor
RT   program";
RL   Tissue Antigens 82(3):201-202(2013).
XX
DR   MD5; 077654b7c5327a117635305ae68b4988.
DR   IMGT/HLA; DRB1*15:87; HLA08912.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..271
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*15:87"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:H8WV97"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:H8WV97"
FT                   /protein_id="CCF77342.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYVVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*15:87"
FT                   /number=2
XX
SQ   Sequence 271 BP; 55 A; 66 C; 100 G; 50 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgtgg       240
     ttgtggagag cttcacagtg cagcggcgag t                                      271
//


spacer
spacer