Dbfetch

ID   HE654761; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE654761;
XX
DT   11-MAR-2012 (Rel. 112, Created)
DT   03-SEP-2014 (Rel. 122, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   DRB1*14:05:04, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RG   BGI HLA novel-allele working group
RA   ;
RT   ;
RL   Submitted (11-JAN-2012) to the INSDC.
RL   BGI, Main Building 9/F, Beishan Industrial Zone, Yantia, Shenzhen 518083,
RL   CHINA.
XX
RN   [2]
RX   DOI; 10.1111/tan.12167.
RX   PUBMED; 23826662.
RA   Zhang C., Wang Y., Huang C., Zhang M., Chen C., Cao H., Chai X., Li J.;
RT   "Characterization of 27 novel HLA class II alleles from China marrow donor
RT   program";
RL   Tissue Antigens 82(3):201-202(2013).
XX
DR   MD5; 829830c95800400b845fff2d93d81671.
DR   IMGT/HLA; DRB1*14:05:04; HLA08588.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*14:05:04"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:H8WV89"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:H8WV89"
FT                   /protein_id="CCF77334.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*14:05:04"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 63 C; 98 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgttg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//