Dbfetch

ID   HE605046; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE605046;
XX
DT   20-OCT-2011 (Rel. 110, Created)
DT   20-OCT-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allelel
DE   HLA-DRB1*03new, Taiwan isolate, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Yang E.;
RT   ;
RL   Submitted (19-OCT-2011) to the INSDC.
RL   Yang E., Tzu Chi Stem Cells Center, Buddhist Tzu Chi General Hospital, 707
RL   Section 3 Chung Yang Road, Hualien 970, TAIWAN.
XX
RN   [2]
RA   Yang E.K.L.;
RT   "Discovery of a new HLA-DR gene in Taiwan";
RL   Unpublished.
XX
DR   MD5; f5d9f1238b4a17928dd4c70a197e18e2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB"
FT                   /allele="HLA-DRB1*03new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:G4VV07"
FT                   /db_xref="IMGT/HLA:DRB1*03:77"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G4VV07"
FT                   /protein_id="CCE34943.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGQFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1*03"
FT                   /allele="HLA-DRB1*03new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 65 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     ggcagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//