spacer

EBI Dbfetch

ID   HE602370; SV 1; linear; genomic DNA; STD; HUM; 1293 BP.
XX
AC   HE602370;
XX
DT   11-OCT-2011 (Rel. 110, Created)
DT   11-OCT-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*02New, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1293
RA   Tourne S.;
RT   ;
RL   Submitted (07-OCT-2011) to the INSDC.
RL   Tourne S., EFS Alsace, Laboratoire d histocompatibilite, 10 rue Spielmann,
RL   67065 Strasbourg Cedex, FRANCE.
XX
RN   [2]
RA   Delbos F., Weschler B., Froelich N., Leisenbach R., Schell A., Bert S.,
RA   Hanau D., Tourne S.;
RT   "The new HLA-C*02 allele has a nucleotide change from HLA-C*02:02:02 (a A
RT   to G) at position 289 (exon 2), which induces the substitution of the
RT   amino-acid at position 73 (a Threonine to an Alanine)";
RL   Unpublished.
XX
DR   MD5; cfed59580397e2916ee29fef493bfeb6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1293
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /PCR_primers="fwd_name: P5' AlaC*-9*3 (Intron 1), fwd_seq:
FT                   mtcctgctgctctcgggagc, rev_name: P3' Int7C (Intron 7),
FT                   rev_seq: aggccttttccctctgccc"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,547..822,1018..>1293)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02New"
FT                   /product="MHC class I molecule"
FT                   /function="Antigen presenting molecule"
FT                   /db_xref="GOA:G4VTY3"
FT                   /db_xref="IMGT/HLA:C*02:55"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G4VTY3"
FT                   /protein_id="CCE14948.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPTEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02New"
FT                   /number=2
FT   intron          271..546
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02New"
FT                   /number=2
FT   gap             435..534
FT                   /estimated_length=unknown
FT   exon            547..822
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02New"
FT                   /number=3
FT   intron          823..1017
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02New"
FT                   /number=3
FT   gap             851..950
FT                   /estimated_length=unknown
FT   exon            1018..>1293
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*02New"
FT                   /number=4
XX
SQ   Sequence 1293 BP; 220 A; 347 C; 369 G; 157 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctccgg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngggcgg       540
     ggccagggtc tcacaccctc cagaggatgt acggctgcga cctggggccc gacgggcgcc       600
     tcctccgcgg gtatgaccag tccgcctacg acggcaagga ttacatcgcc ctgaacgagg       660
     acctgcgctc ctggaccgcc gcggacacag cggctcagat cacccagcgc aagtgggagg       720
     cggcccgtga ggcggagcag tggagagcct acctggaggg cgagtgcgtg gagtggctcc       780
     gcagatacct ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg       840
     agccttcccc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn catgggcgct       960
     gttggagtgt cgcaagagag atacaaagtg tctgaatttt ctgactcttc ccgtcagaac      1020
     acccaaagac acacgtgacc caccatcccg tctctgacca tgaggccacc ctgaggtgct      1080
     gggccctggg cttctaccct acggagatca cactgacctg gcagcgggat ggcgaggacc      1140
     aaactcagga caccgagctt gtggagacca ggccagcagg agatggaacc ttccagaagt      1200
     gggcagctgt ggtggtgcct tctggagaag agcagagata cacgtgccat gtgcagcacg      1260
     aggggctgcc ggagcccctc accctgagat ggg                                   1293
//


spacer
spacer