spacer

EBI Dbfetch

ID   HE585128; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   HE585128;
XX
DT   30-AUG-2011 (Rel. 109, Created)
DT   30-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, isolate 48029,
DE   allele HLA-Cw*04, exon 4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Gervais T.G.;
RT   ;
RL   Submitted (26-AUG-2011) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Tower R. Franklin -
RL   Molecular Biology, Level 0 N - Avenue Hippocrate 10, Brussels, 1200,
RL   BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Larinne D.;
RT   "New HLA-Cw*04 allele identified by Sequence-Based Typing";
RL   Unpublished.
XX
DR   MD5; 61226026b4c4f45b7238dbd54a9410aa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="48029"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*04:106"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:G3CC15"
FT                   /protein_id="CCD31404.1"
FT                   /translation="HPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04"
FT                   /number=4
XX
SQ   Sequence 276 BP; 66 A; 81 C; 86 G; 43 T; 0 other;
     aacacccaaa gacacacgtg acccaccatc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagtgg gatggggagg       120
     accaaactca ggacaccgag cttgtggaga ccaggccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacgtgc catgttcagc       240
     acgaggggct gccggagccc ctcaccctga gatgga                                 276
//


spacer
spacer