spacer

EBI Dbfetch

ID   HE585127; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   HE585127;
XX
DT   30-AUG-2011 (Rel. 109, Created)
DT   30-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, isolate 48029,
DE   allele HLA-Cw*04, exon 3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Gervais T.G.;
RT   ;
RL   Submitted (26-AUG-2011) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Tower R. Franklin -
RL   Molecular Biology, Level 0 N - Avenue Hippocrate 10, Brussels, 1200,
RL   BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Larinne D.;
RT   "New HLA-Cw*04 allele identified by Sequence-Based Typing";
RL   Unpublished.
XX
DR   MD5; 0ab59192f06f7dd0d71ef56a68856e2f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="48029"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:G3CC14"
FT                   /db_xref="IMGT/HLA:C*04:106"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G3CC14"
FT                   /protein_id="CCD31403.1"
FT                   /translation="SHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04"
FT                   /number=3
XX
SQ   Sequence 276 BP; 52 A; 85 C; 102 G; 37 T; 0 other;
     ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggatctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer