spacer

EBI Dbfetch

ID   HE585126; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE585126;
XX
DT   30-AUG-2011 (Rel. 109, Created)
DT   30-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, isolate 48029,
DE   allele HLA-Cw*04, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (26-AUG-2011) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Tower R. Franklin -
RL   Molecular Biology, Level 0 N - Avenue Hippocrate 10, Brussels, 1200,
RL   BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Larinne D.;
RT   "New HLA-Cw*04 allele identified by Sequence-Based Typing";
RL   Unpublished.
XX
DR   MD5; cde945a79687dbc2558ffdaf35b2f521.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="48029"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:G3CC13"
FT                   /db_xref="IMGT/HLA:C*04:106"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:G3CC13"
FT                   /protein_id="CCD31402.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSED"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 80 C; 98 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer