spacer

EBI Dbfetch

ID   HE583187; SV 1; circular; other DNA; STD; SYN; 8454 BP.
XX
AC   HE583187;
XX
DT   19-AUG-2011 (Rel. 109, Created)
DT   19-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Shuttle vector pSenOAS
XX
KW   .
XX
OS   Shuttle vector pSenOAS
OC   other sequences; artificial sequences; vectors.
XX
OS   Shuttle vector pJC1
OC   other sequences; artificial sequences; vectors.
XX
OS   Corynebacterium glutamicum
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Corynebacterineae; Corynebacteriaceae; Corynebacterium.
XX
OS   Shuttle vector pEKEx2-Eyfp
OC   other sequences; artificial sequences; vectors.
XX
RN   [1]
RP   1-8454
RA   Binder S.;
RT   ;
RL   Submitted (12-AUG-2011) to the INSDC.
RL   Binder S., Forschungszentrum Juelich GmbH, IBG-1: Biotechnologie,
RL   Leo-Brandt-Str, 52425, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2012-13-5-r40.
RX   PUBMED; 22640862.
RA   Binder S., Schendzielorz G., Stabler N., Krumbach K., Hoffmann K., Bott M.,
RA   Eggeling L.;
RT   "A high-throughput approach to identify genomic variants of bacterial
RT   metabolite producers at the single-cell level";
RL   Genome Biol. 13(5):R40-R40(2012).
XX
DR   MD5; dbf4983171988cdf88705e08494bdc5c.
DR   EuropePMC; PMC3446293; 22640862.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8454
FT                   /organism="Shuttle vector pSenOAS"
FT                   /focus
FT                   /lab_host="Corynebacterium glutamicum"
FT                   /lab_host="Escherichia coli"
FT                   /mol_type="other DNA"
FT                   /note="OAS biosensor"
FT                   /db_xref="taxon:1077181"
FT   source          1..7
FT                   /organism="Shuttle vector pJC1"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077178"
FT   source          8..1637
FT                   /organism="Corynebacterium glutamicum"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1718"
FT   source          1638..2357
FT                   /organism="Shuttle vector pEKEx2-Eyfp"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077177"
FT   source          2358..8454
FT                   /organism="Shuttle vector pJC1"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077178"
FT   CDS             complement(6..1172)
FT                   /transl_table=11
FT                   /gene="CysR"
FT                   /product="ROK-type regulator"
FT                   /protein_id="CCD28591.1"
FT                   /translation="MIGYGLPMPNQAHFSASFARPSTPAAKCMHHIRLGQQLIRNELVE
FT                   ATGLSQPTVTRAVTALMQAGLVRERPDLTLSSGPGRPNIPLELAPSPWIHAGVAIGTKS
FT                   SYVALFDTKGRTLRDAMLEISAADLDPDTFIEHLIAGVNRLTTGLDLPLVGIGVATSGK
FT                   VTNAGVVTASNLGWDGVDIAGRLNYQFSVPATVASAIPAIAASELQASPLPHPEQPTPI
FT                   TLTFYADDSVGAAYSNDLGVHVIGPLATTRGSGLDTLGMAAEDALSTQGFLSRVSDQGI
FT                   FANSLGELVTIAKDNETAREFLNDRATLLAHTAAEAAETVKPSTLVLSGSAFSEDPQGR
FT                   SVFASQLKKEYDADIELRLIPTHRENVRAAARAVALDRLLNEPLTLVP"
FT   CDS             1635..2354
FT                   /transl_table=11
FT                   /gene="eyfp"
FT                   /product="autofluorescent protein"
FT                   /protein_id="CCD28592.1"
FT                   /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
FT                   KFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
FT                   GNYKTRAEVKFEGDTLVNRIELKGINFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
FT                   VNFKIRHNIEGGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
FT                   EFVTAAGITLGMDELYK"
XX
SQ   Sequence 8454 BP; 2079 A; 2284 C; 2218 G; 1873 T; 0 other;
     tcgacttagg gtacgagagt aagtggctcg ttgagtagtc gatcaagtgc gactgctcga        60
     gctgctgcgc ggacgttttc ccggtgggtg gggatcaacc ggagctcaat gtctgcgtcg       120
     tattccttct tcaattggga agcgaacacc gaccgacctt gtggatcttc ggaaaacgcc       180
     gatcccgaga gaaccagggt ggatggctta actgtttcgg cagcttctgc ggcagtgtga       240
     gccagcaggg tcgcgcgatc gttgaggaat tcccgtgcgg tttcattgtc tttagcaatg       300
     gtgactagct caccaaggct gttggcaaag ataccctgat cagaaaccct gcttaagaaa       360
     ccttgggtgc tcagcgcatc ttcggcagcc atgcccaaag tatccaaacc tgatccacga       420
     gttgtagcca gtggtccaat gacatgtact cccaaatcat tgctgtaggc cgcgcccaca       480
     gagtcatcgg cgtagaaggt caaggtgatg ggagttggct gctcagggtg gggaagtggg       540
     gaagcctgca gttcagaagc tgcgatggca ggaattgctg atgccacggt tgctggaacg       600
     ctgaattggt agttcaggcg gccagcgata tcaacgccat cccagcccaa gttgcttgcg       660
     gtgacaacgc ctgcgttggt gacttttcct gaggtggcaa caccaatacc taccagtggt       720
     agatcaagac cagtggtgag gcggttgaca ccagcaatga ggtgttcgat gaaagtgtct       780
     ggatctaaat cagctgctga gatttccagc atggcatcac gaagggtgcg acccttggta       840
     tcaaacaaag cgacgtagga agacttggtg ccgattgcca cgcctgcatg aatccatgga       900
     cttggagcga gttctagagg aatattggga cgaccagggc ccgatgagag tgtgagatca       960
     gggcgttcac gaaccaaacc tgcctgcatt aaagcggtga ctgcgcgggt gacagtcggt      1020
     tgggacagac ctgtggcctc gaccagctca tttctaatga gttgctggcc gaggcggata      1080
     tggtgcatgc actttgcagc cggggtagag gggcgggcaa aggacgcaga gaagtgggcc      1140
     tgattgggca taggtaaacc atagccaatc atagacaacg ctgtctaata ggggtcttgt      1200
     tatctagacc gcattgtctg taaatgggca tggataagta tttagatgcc ggtaattttt      1260
     ggtttctcgt atttccagaa tttaggcacc gccaccatac aaattgcagt gagtacaacc      1320
     accgctactc cgccccataa taccgtccaa cctgccacta caccacaggc ttccggaagt      1380
     tgcacattgg aaaaaccctt agataaatat tgaaatatga atttaataat agattccgaa      1440
     cgaaatcggt gttagcgtct gtgctgaaac aatctaatcg cgtttcagga cacctacatg      1500
     atcaggagct ctttttgtta aacagagtca gtcgtattgc aggcgcttct gcaatcacac      1560
     tatgcatcgg cttaaccaca atactaagcc ctacttccac tgcacaaagc tgaactttaa      1620
     gaaggagata tcatatggtg agcaagggcg aggagctgtt caccggggtg gtgcccatcc      1680
     tggtcgagct ggacggcgac gtaaacggcc acaagttcag cgtgtccggc gagggcgagg      1740
     gcgatgccac ctacggcaag ctgaccctga agttcatctg caccaccggc aagctgcccg      1800
     tgccctggcc caccctcgtg accaccttcg gctacggcct gcagtgcttc gcccgctacc      1860
     ccgaccacat gaagcagcac gacttcttca agtccgccat gcccgaaggc tacgtccagg      1920
     agcgcaccat cttcttcaag gacgacggca actacaagac ccgcgccgag gtgaagttcg      1980
     agggcgacac cctggtgaac cgcatcgagc tgaagggcat caacttcaag gaggacggca      2040
     acatcctggg gcacaagctg gagtacaact acaacagcca caacgtctat atcatggccg      2100
     acaagcagaa gaacggcatc aaggtgaact tcaagatccg ccacaacatc gagggcggca      2160
     gcgtgcagct cgccgaccac taccagcaga acacccccat cggcgacggc cccgtgctgc      2220
     tgcccgacaa ccactacctg agctaccagt ccgccctgag caaagacccc aacgagaagc      2280
     gcgatcacat ggtcctgctg gagttcgtga ccgccgccgg gatcactctc ggcatggacg      2340
     agctgtacaa gtaataagga tccccctgcg gcgtcgctga tcgccctcgc gacgttgtgc      2400
     gggtggcttg tccctgaggg cgctgcgaca gatagctaaa aatctgcgtc aggatcgccg      2460
     tagagcgcgc gtcgcgtcga ttggaggctt cccctttggt tgacggtctt caatcgctct      2520
     acggcgatcc tgacgctttt ttgttgcgta ccgtcgatcg ttttatttct gtcgatcccg      2580
     aaaaagtttt tgccttttgt aaaaaacttc tcggtcgccc cgcaaatttt cgattccaga      2640
     ttttttaaaa accaagccag aaatacgaca caccgtttgc agataatctg tctttcggaa      2700
     aaatcaagtg cgatacaaaa tttttagcac ccctgagctg cgcaaagtcc cgcttcgtga      2760
     aaattttcgt gccgcgtgat tttccgccaa aaactttaac gaacgttcgt tataatggtg      2820
     tcatgacctt cacgacgaag taccaaaatt ggcccgaatc atcagctatg gatctctctg      2880
     atgtcgcgct ggagtccgac gcgctcgatg ctgccgtcga tttaaaaacg gtgatcggat      2940
     ttttccgagc tctcgatacg acggacgcgc cagcatcacg agactgggcc agtgccgcga      3000
     gcgacctaga aactctcgtg gcggatcttg aggagctggc tgacgagctg cgtgctcggc      3060
     agcgccagga ggacgcacag tagtggagga tcgaatcagt tgcgcctact gcggtggcct      3120
     gattcctccc cggcctgacc cgcgaggacg gcgcgcaaaa tattgctcag atgcgtgtcg      3180
     tgccgcagcc agccgcgagc gcgccaacaa acgccacgcc gaggagctgg aggcggctag      3240
     gtcgcaaatg gcgctggaag tgcgtccccc gagcgaaatt ttggccatgg tcgtcacaga      3300
     gctggaagcg gcagcgagaa ttatccgcga tcgtggcgcg gtgcccgcag gcatgacaaa      3360
     catcgtaaat gccgcgtttc gtgtggccgt ggccgcccag gacgtgtcag cgccgccacc      3420
     acctgcaccg aatcggcagc agcgtcgcgc gtcgaaaaag cgcacaggcg gcaagaagcg      3480
     ataagctgca cgaatacctg aaaaatgttg aacgccccgt gagcggtaac tcacagggcg      3540
     tcggctaacc cccagtccaa acctgggaga aagcgctcaa aaatgactct agcggattca      3600
     cgagacattg acacaccggc ctggaaattt tccgctgatc tgttcgacac ccatcccgag      3660
     ctcgcgctgc gatcacgtgg ctggacgagc gaagaccgcc gcgaattcct cgctcacctg      3720
     ggcagagaaa atttccaggg cagcaagacc cgcgacttcg ccagcgcttg gatcaaagac      3780
     ccggacacgg gagaaacaca gccgaagtta taccgagttg gttcaaaatc gcttgcccgg      3840
     tgccagtatg ttgctctgac gcacgcgcag cacgcagccg tgcttgtcct ggacattgat      3900
     gtgccgagcc accaggccgg cgggaaaatc gagcacgtaa accccgaggt ctacgcgatt      3960
     ttggagcgct gggcacgcct ggaaaaagcg ccagcttgga tcggcgtgaa tccactgagc      4020
     gggaaatgcc agctcatctg gctcattgat ccggtgtatg ccgcagcagg catgagcagc      4080
     ccgaatatgc gcctgctggc tgcaacgacc gaggaaatga cccgcgtttt cggcgctgac      4140
     caggcttttt cacataggct gagccggtgg ccactgcacg tctccgacga tcccaccgcg      4200
     taccgctggc atgcccagca caatcgcgtg gatcgcctag ctgatcttat ggaggttgct      4260
     cgcatgatct caggcacaga aaaacctaaa aaacgctatg agcaggagtt ttctagcgga      4320
     cgggcacgta tcgaagcggc aagaaaagcc actgcggaag caaaagcact tgccacgctt      4380
     gaagcaagcc tgccgagcgc cgctgaagcg tctggagagc tgatcgacgg cgtccgtgtc      4440
     ctctggactg ctccagggcg tgccgcccgt gatgagacgg cttttcgcca cgctttgact      4500
     gtgggatacc agttaaaagc ggctggtgag cgcctaaaag acaccaagat catcgacgcc      4560
     tacgagcgtg cctacaccgt cgctcaggcg gtcggagcag acggccgtga gcctgatctg      4620
     ccgccgatgc gtgaccgcca gacgatggcg cgacgtgtgc gcggctacgt cgctaaaggc      4680
     cagccagtcg tccctgctcg tcagacagag acgcagagca gccgagggcg aaaagctctg      4740
     gccactatgg gaagacgtgg cggtaaaaag gccgcagaac gctggaaaga cccaaacagt      4800
     gagtacgccc gagcacagcg agaaaaacta gctaagtcca gtcaacgaca agctaggaaa      4860
     gctaaaggaa atcgcttgac cattgcaggt tggtttatga ctgttgaggg agagactggc      4920
     tcgtggccga caatcaatga agctatgtct gaatttagcg tgtcacgtca gaccgtgaat      4980
     agagcactta agtctgcggg cattgaactt ccacgaggac gccgtaaagc ttcccagtaa      5040
     atgtgccatc tcgtaggcag aaaacggttc cccccgtagg ggtctctctc ttggcctcct      5100
     ttctaggtcg ggctgattgc tcttgaagct ctctaggggg gctcacacca taggcagata      5160
     acggttcccc accggctcac ctcgtaagcg cacaaggact gctcccaaag atcttcaaag      5220
     ccactgccgc gactccgctt cgcgaagcct tgccccgcgg aaatttcctc caccgagttc      5280
     gtgcacaccc ctatgccaag cttctttcac cctaaattcg agagattgga ttcttaccgt      5340
     ggaaattctt cgcaaaaatc gtcccctgat cgcccttgcg acgttgctcg cggcggtgcc      5400
     gctggttgcg cttggcttga ccgacttgat cctccggcgt tcagcctgtg ccacagccga      5460
     caggatggtg accaccattt gccccatatc accgtcggta ctgatcccgt cgtcaataaa      5520
     ccgaaccgct acaccctgag catcaaactc ttttatcagt tggatcatgt cggcggtgtc      5580
     gcggccaaga cggtcgagct tcttcaccag aatgacatca ccttcctcca ccttcatcct      5640
     cagcaaatcc agcccttccc gatctgttga actgccggat gccttgtcgg taaagatgcg      5700
     gttagctttt acccctgcat ctttgagcgc tgaggtctgc ctcgtgaaga aggtgttgct      5760
     gactcatacc aggcctgaat cgccccatca tccagccaga aagtgaggga gccacggttg      5820
     atgagagctt tgttgtaggt ggaccagttg gtgattttga acttttgctt tgccacggaa      5880
     cggtctgcgt tgtcgggaag atgcgtgatc tgatccttca actcagcaaa agttcgattt      5940
     attcaacaaa gccgccgtcc cgtcaagtca gcgtaatgct ctgccagtgt tacaaccaat      6000
     taaccaattc tgattagaaa aactcatcga gcatcaaatg aaactgcaat ttattcatat      6060
     caggattatc aataccatat ttttgaaaaa gccgtttctg taatgaagga gaaaactcac      6120
     cgaggcagtt ccataggatg gcaagatcct ggtatcggtc tgcgattccg actcgtccaa      6180
     catcaataca acctattaat ttcccctcgt caaaaataag gttatcaagt gagaaatcac      6240
     catgagtgac gactgaatcc ggtgagaatg gcaaaagctt atgcatttct ttccagactt      6300
     gttcaacagg ccagccatta cgctcgtcat caaaatcact cgcatcaacc aaaccgttat      6360
     tcattcgtga ttgcgcctga gcgagacgaa atacgcgatc gctgttaaaa ggacaattac      6420
     aaacaggaat cgaatgcaac cggcgcagga acactgccag cgcatcaaca atattttcac      6480
     ctgaatcagg atattcttct aatacctgga atgctgtttt cccggggatc gcagtggtga      6540
     gtaaccatgc atcatcagga gtacggataa aatgcttgat ggtcggaaga ggcataaatt      6600
     ccgtcagcca gtttagtctg accatctcat ctgtaacatc attggcaacg ctacctttgc      6660
     catgtttcag aaacaactct ggcgcatcgg gcttcccata caatcgatag attgtcgcac      6720
     ctgattgccc gacattatcg cgagcccatt tatacccata taaatcagca tccatgttgg      6780
     aatttaatcg cggcctcgag caagacgttt cccgttgaat atggctcata acaccccttg      6840
     tattactgtt tatgtaagca gacagtttta ttgttcatga tgatatattt ttatcttgtg      6900
     caatgtaaca tcagagattt tgagacacaa cgtggctttg ttgaataaat cgaacttttg      6960
     ctgagttgaa ggatcagatc acgcatcttc ccgacaacgc agaccgttcc gtggcaaagc      7020
     aaaagttcaa aatcaccaac tggtccacct acaacaaagc tctcatcaac cgtggctccc      7080
     tcactttctg gctggatgat ggggcgattc aggcctggta tgagtcagca acaccttctt      7140
     cacgaggcag acctcagcgc tagcggagtg tatactggct tactatgttg gcactgatga      7200
     gggtgtcagt gaagtgcttc atgtggcagg agaaaaaagg ctgcaccggt gcgtcagcag      7260
     aatatgtgat acaggatata ttccgcttcc tcgctcactg actcgctacg ctcggtcgtt      7320
     cgactgcggc gagcggaaat ggcttacgaa cggggcggag atttcctgga agatgccagg      7380
     aagatactta acagggaagt gagagggccg cggcaaagcc gtttttccat aggctccgcc      7440
     cccctgacaa gcatcacgaa atctgacgct caaatcagtg gtggcgaaac ccgacaggac      7500
     tataaagata ccaggcgttt ccccctggcg gctccctcgt gcgctctcct gttcctgcct      7560
     ttcggtttac cggtgtcatt ccgctgttat ggccgcgttt gtctcattcc acgcctgaca      7620
     ctcagttccg ggtaggcagt tcgctccaag ctggactgta tgcacgaacc ccccgttcag      7680
     tccgaccgct gcgccttatc cggtaactat cgtcttgagt ccaacccgga aagacatgca      7740
     aaagcaccac tggcagcagc cactggtaat tgatttagag gagttagtct tgaagtcatg      7800
     cgccggttaa ggctaaactg aaaggacaag ttttggtgac tgcgctcctc caagccagtt      7860
     acctcggttc aaagagttgg tagctcagag aaccttcgaa aaaccgccct gcaaggcggt      7920
     tttttcgttt tcagagcaag agattacgcg cagaccaaaa cgatctcaag aagatcatct      7980
     tattaagggg tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgag      8040
     attatcaaaa aggatcttca cctagatcct tttaaattaa aaatgaagtt ttaaatcaat      8100
     ctaaagtata tatgagtaaa cttggtctga cagttaccaa tgcttaatca gtgaggcacc      8160
     tatctcagcg atctgtctat ttcgttcatc catagttgcc tgactccccg tcgtgtagat      8220
     aactacgata cgggagggct taccatctgg ccccagtgct gcaatgatac cgcgagaccc      8280
     acgctcaccg gctccagatt tatcagcaat aaaccagcca gccggaaggg ccgagcgcag      8340
     aagtggtcct gcaactttat ccgcctccat ccagtctatt aattgttgcc gggaagctag      8400
     agtaagtagt tcgccagtta atagtttgcg caacgttgtt gccattgctg cagg            8454
//


spacer
spacer