spacer

EBI Dbfetch

ID   HE583185; SV 1; circular; other DNA; STD; SYN; 8155 BP.
XX
AC   HE583185;
XX
DT   19-AUG-2011 (Rel. 109, Created)
DT   19-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Shuttle vector pSenArg
XX
KW   .
XX
OS   Shuttle vector pSenArg
OC   other sequences; artificial sequences; vectors.
XX
OS   Shuttle vector pEKEx2-Eyfp
OC   other sequences; artificial sequences; vectors.
XX
OS   Corynebacterium glutamicum
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Corynebacterineae; Corynebacteriaceae; Corynebacterium.
XX
OS   Shuttle vector pJC1
OC   other sequences; artificial sequences; vectors.
XX
RN   [1]
RP   1-8155
RA   Binder S.;
RT   ;
RL   Submitted (12-AUG-2011) to the INSDC.
RL   Binder S., Forschungszentrum Juelich GmbH, IBG-1: Biotechnologie,
RL   Leo-Brandt-Str, 52425, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2012-13-5-r40.
RX   PUBMED; 22640862.
RA   Binder S., Schendzielorz G., Stabler N., Krumbach K., Hoffmann K., Bott M.,
RA   Eggeling L.;
RT   "A high-throughput approach to identify genomic variants of bacterial
RT   metabolite producers at the single-cell level";
RL   Genome Biol. 13(5):R40-R40(2012).
XX
DR   MD5; 730da05219069cdda90577535c112a68.
DR   EuropePMC; PMC3446293; 22640862.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8155
FT                   /organism="Shuttle vector pSenArg"
FT                   /focus
FT                   /lab_host="Corynebacterium glutamicum"
FT                   /lab_host="Escherichia coli"
FT                   /mol_type="other DNA"
FT                   /note="L-arginine biosensor"
FT                   /db_xref="taxon:1077179"
FT   source          1..726
FT                   /organism="Shuttle vector pEKEx2-Eyfp"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077177"
FT   source          727..2060
FT                   /organism="Corynebacterium glutamicum"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1718"
FT   source          2061..8155
FT                   /organism="Shuttle vector pJC1"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077178"
FT   CDS             complement(10..729)
FT                   /transl_table=11
FT                   /gene="eyfp"
FT                   /product="autofluorescent protein"
FT                   /protein_id="CCD28587.1"
FT                   /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
FT                   KFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
FT                   GNYKTRAEVKFEGDTLVNRIELKGINFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
FT                   VNFKIRHNIEGGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
FT                   EFVTAAGITLGMDELYK"
FT   CDS             1166..2059
FT                   /transl_table=11
FT                   /gene="argP"
FT                   /product="LTTR"
FT                   /protein_id="CCD28588.1"
FT                   /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENM
FT                   FGQPLLVRTVPPRPTEQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLAT
FT                   WLLPALAPVLADSPIRLNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALD
FT                   YLFVSSKPFAEKYFPNGVTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVN
FT                   SSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRK
FT                   VTDALLDYGHKVLRQD"
XX
SQ   Sequence 8155 BP; 1848 A; 2100 C; 2237 G; 1970 T; 0 other;
     ggatccttat tacttgtaca gctcgtccat gccgagagtg atcccggcgg cggtcacgaa        60
     ctccagcagg accatgtgat cgcgcttctc gttggggtct ttgctcaggg cggactggta       120
     gctcaggtag tggttgtcgg gcagcagcac ggggccgtcg ccgatggggg tgttctgctg       180
     gtagtggtcg gcgagctgca cgctgccgcc ctcgatgttg tggcggatct tgaagttcac       240
     cttgatgccg ttcttctgct tgtcggccat gatatagacg ttgtggctgt tgtagttgta       300
     ctccagcttg tgccccagga tgttgccgtc ctccttgaag ttgatgccct tcagctcgat       360
     gcggttcacc agggtgtcgc cctcgaactt cacctcggcg cgggtcttgt agttgccgtc       420
     gtccttgaag aagatggtgc gctcctggac gtagccttcg ggcatggcgg acttgaagaa       480
     gtcgtgctgc ttcatgtggt cggggtagcg ggcgaagcac tgcaggccgt agccgaaggt       540
     ggtcacgagg gtgggccagg gcacgggcag cttgccggtg gtgcagatga acttcagggt       600
     cagcttgccg taggtggcat cgccctcgcc ctcgccggac acgctgaact tgtggccgtt       660
     tacgtcgccg tccagctcga ccaggatggg caccaccccg gtgaacagct cctcgccctt       720
     gctcaccata tgatatctcc ttcttaaagt tcacgactgc atcaataacg cgctgccacc       780
     aaaaatcccg gcgcaaatca ggaccaaatc gctgatagca caaagtaagg caatcataat       840
     gtggtactga cgacgtatgc cctgattcat cacaaaagca ttttgtggac cgagcggtag       900
     gatcatagcc gccccaagtg caagaccttg aaagtaataa gaaaacacgt tggatattcc       960
     gaattaagta tctgatgcag agactatatc gcgggattgt tattagcgga aattgataat      1020
     attaattggc aatcagaaaa actaataaga gagaggccag agagtattat ctggcctcag      1080
     cgttgatggt acccggtata tgcaacctga cacaaaattg tgtcatagtg caggaaaaag      1140
     catttaccag gagcagacaa cagcaatgaa acgcccggac tacagaacat tacaggcact      1200
     ggatgcggtg atacgtgaac gaggatttga gcgcgcggca caaaagctgt gcattacaca      1260
     atcagccgtc tcacagcgca ttaagcaact ggaaaatatg ttcgggcagc cgctgttggt      1320
     gcgtaccgta ccgccgcgcc cgacggaaca agggcaaaaa ctgctggcac tgctgcgcca      1380
     ggtggagttg ctggaagaag agtggctggg cgatgaacaa accggttcga ctccgctgct      1440
     gctttcactg gcggtcaacg ccgacagtct ggcgacgtgg ttgcttcctg cactggctcc      1500
     tgtgttggct gattcgccta tccgcctcaa cttgcaggta gaagatgaaa cccgcactca      1560
     ggaacgtctg cgccgcggcg aagtggtcgg cgcggtgagt attcaacatc aggcgctgcc      1620
     gagttgtctt gtcgataaac ttggtgcgct cgactatctg ttcgtcagct caaaaccctt      1680
     tgccgaaaaa tatttcccta acggcgtaac gcgttcggca ttactgaaag cgccagtggt      1740
     cgcgtttgac catcttgacg atatgcacca ggcctttttg cagcaaaact tcgatctgcc      1800
     tccaggcagc gtgccctgcc atatcgttaa ttcttcagaa gcgttcgtac aacttgctcg      1860
     ccagggcacc acctgctgta tgatcccgca cctgcaaatc gagaaagagc tggccagcgg      1920
     tgaactgatt gacttaacgc ctgggctatt tcaacgacgg atgctctact ggcaccgctt      1980
     tgctcctgaa agccgcatga tgcgtaaagt cactgatgcg ttactcgatt atggtcacaa      2040
     agtccttcgt caggattaag tcgacctgca gcaatggcaa caacgttgcg caaactatta      2100
     actggcgaac tacttactct agcttcccgg caacaattaa tagactggat ggaggcggat      2160
     aaagttgcag gaccacttct gcgctcggcc cttccggctg gctggtttat tgctgataaa      2220
     tctggagccg gtgagcgtgg gtctcgcggt atcattgcag cactggggcc agatggtaag      2280
     ccctcccgta tcgtagttat ctacacgacg gggagtcagg caactatgga tgaacgaaat      2340
     agacagatcg ctgagatagg tgcctcactg attaagcatt ggtaactgtc agaccaagtt      2400
     tactcatata tactttagat tgatttaaaa cttcattttt aatttaaaag gatctaggtg      2460
     aagatccttt ttgataatct catgaccaaa atcccttaac gtgagttttc gttccactga      2520
     gcgtcagacc ccttaataag atgatcttct tgagatcgtt ttggtctgcg cgtaatctct      2580
     tgctctgaaa acgaaaaaac cgccttgcag ggcggttttt cgaaggttct ctgagctacc      2640
     aactctttga accgaggtaa ctggcttgga ggagcgcagt caccaaaact tgtcctttca      2700
     gtttagcctt aaccggcgca tgacttcaag actaactcct ctaaatcaat taccagtggc      2760
     tgctgccagt ggtgcttttg catgtctttc cgggttggac tcaagacgat agttaccgga      2820
     taaggcgcag cggtcggact gaacgggggg ttcgtgcata cagtccagct tggagcgaac      2880
     tgcctacccg gaactgagtg tcaggcgtgg aatgagacaa acgcggccat aacagcggaa      2940
     tgacaccggt aaaccgaaag gcaggaacag gagagcgcac gagggagccg ccagggggaa      3000
     acgcctggta tctttatagt cctgtcgggt ttcgccacca ctgatttgag cgtcagattt      3060
     cgtgatgctt gtcagggggg cggagcctat ggaaaaacgg ctttgccgcg gccctctcac      3120
     ttccctgtta agtatcttcc tggcatcttc caggaaatct ccgccccgtt cgtaagccat      3180
     ttccgctcgc cgcagtcgaa cgaccgagcg tagcgagtca gtgagcgagg aagcggaata      3240
     tatcctgtat cacatattct gctgacgcac cggtgcagcc ttttttctcc tgccacatga      3300
     agcacttcac tgacaccctc atcagtgcca acatagtaag ccagtataca ctccgctagc      3360
     gctgaggtct gcctcgtgaa gaaggtgttg ctgactcata ccaggcctga atcgccccat      3420
     catccagcca gaaagtgagg gagccacggt tgatgagagc tttgttgtag gtggaccagt      3480
     tggtgatttt gaacttttgc tttgccacgg aacggtctgc gttgtcggga agatgcgtga      3540
     tctgatcctt caactcagca aaagttcgat ttattcaaca aagccacgtt gtgtctcaaa      3600
     atctctgatg ttacattgca caagataaaa atatatcatc atgaacaata aaactgtctg      3660
     cttacataaa cagtaataca aggggtgtta tgagccatat tcaacgggaa acgtcttgct      3720
     cgaggccgcg attaaattcc aacatggatg ctgatttata tgggtataaa tgggctcgcg      3780
     ataatgtcgg gcaatcaggt gcgacaatct atcgattgta tgggaagccc gatgcgccag      3840
     agttgtttct gaaacatggc aaaggtagcg ttgccaatga tgttacagat gagatggtca      3900
     gactaaactg gctgacggaa tttatgcctc ttccgaccat caagcatttt atccgtactc      3960
     ctgatgatgc atggttactc accactgcga tccccgggaa aacagcattc caggtattag      4020
     aagaatatcc tgattcaggt gaaaatattg ttgatgcgct ggcagtgttc ctgcgccggt      4080
     tgcattcgat tcctgtttgt aattgtcctt ttaacagcga tcgcgtattt cgtctcgctc      4140
     aggcgcaatc acgaatgaat aacggtttgg ttgatgcgag tgattttgat gacgagcgta      4200
     atggctggcc tgttgaacaa gtctggaaag aaatgcataa gcttttgcca ttctcaccgg      4260
     attcagtcgt cactcatggt gatttctcac ttgataacct tatttttgac gaggggaaat      4320
     taataggttg tattgatgtt ggacgagtcg gaatcgcaga ccgataccag gatcttgcca      4380
     tcctatggaa ctgcctcggt gagttttctc cttcattaca gaaacggctt tttcaaaaat      4440
     atggtattga taatcctgat atgaataaat tgcagtttca tttgatgctc gatgagtttt      4500
     tctaatcaga attggttaat tggttgtaac actggcagag cattacgctg acttgacggg      4560
     acggcggctt tgttgaataa atcgaacttt tgctgagttg aaggatcaga tcacgcatct      4620
     tcccgacaac gcagaccgtt ccgtggcaaa gcaaaagttc aaaatcacca actggtccac      4680
     ctacaacaaa gctctcatca accgtggctc cctcactttc tggctggatg atggggcgat      4740
     tcaggcctgg tatgagtcag caacaccttc ttcacgaggc agacctcagc gctcaaagat      4800
     gcaggggtaa aagctaaccg catctttacc gacaaggcat ccggcagttc aacagatcgg      4860
     gaagggctgg atttgctgag gatgaaggtg gaggaaggtg atgtcattct ggtgaagaag      4920
     ctcgaccgtc ttggccgcga caccgccgac atgatccaac tgataaaaga gtttgatgct      4980
     cagggtgtag cggttcggtt tattgacgac gggatcagta ccgacggtga tatggggcaa      5040
     atggtggtca ccatcctgtc ggctgtggca caggctgaac gccggaggat caagtcggtc      5100
     aagccaagcg caaccagcgg caccgccgcg agcaacgtcg caagggcgat caggggacga      5160
     tttttgcgaa gaatttccac ggtaagaatc caatctctcg aatttagggt gaaagaagct      5220
     tggcataggg gtgtgcacga actcggtgga ggaaatttcc gcggggcaag gcttcgcgaa      5280
     gcggagtcgc ggcagtggct ttgaagatct ttgggagcag tccttgtgcg cttacgaggt      5340
     gagccggtgg ggaaccgtta tctgcctatg gtgtgagccc ccctagagag cttcaagagc      5400
     aatcagcccg acctagaaag gaggccaaga gagagacccc tacgggggga accgttttct      5460
     gcctacgaga tggcacattt actgggaagc tttacggcgt cctcgtggaa gttcaatgcc      5520
     cgcagactta agtgctctat tcacggtctg acgtgacacg ctaaattcag acatagcttc      5580
     attgattgtc ggccacgagc cagtctctcc ctcaacagtc ataaaccaac ctgcaatggt      5640
     caagcgattt cctttagctt tcctagcttg tcgttgactg gacttagcta gtttttctcg      5700
     ctgtgctcgg gcgtactcac tgtttgggtc tttccagcgt tctgcggcct ttttaccgcc      5760
     acgtcttccc atagtggcca gagcttttcg ccctcggctg ctctgcgtct ctgtctgacg      5820
     agcagggacg actggctggc ctttagcgac gtagccgcgc acacgtcgcg ccatcgtctg      5880
     gcggtcacgc atcggcggca gatcaggctc acggccgtct gctccgaccg cctgagcgac      5940
     ggtgtaggca cgctcgtagg cgtcgatgat cttggtgtct tttaggcgct caccagccgc      6000
     ttttaactgg tatcccacag tcaaagcgtg gcgaaaagcc gtctcatcac gggcggcacg      6060
     ccctggagca gtccagagga cacggacgcc gtcgatcagc tctccagacg cttcagcggc      6120
     gctcggcagg cttgcttcaa gcgtggcaag tgcttttgct tccgcagtgg cttttcttgc      6180
     cgcttcgata cgtgcccgtc cgctagaaaa ctcctgctca tagcgttttt taggtttttc      6240
     tgtgcctgag atcatgcgag caacctccat aagatcagct aggcgatcca cgcgattgtg      6300
     ctgggcatgc cagcggtacg cggtgggatc gtcggagacg tgcagtggcc accggctcag      6360
     cctatgtgaa aaagcctggt cagcgccgaa aacgcgggtc atttcctcgg tcgttgcagc      6420
     cagcaggcgc atattcgggc tgctcatgcc tgctgcggca tacaccggat caatgagcca      6480
     gatgagctgg catttcccgc tcagtggatt cacgccgatc caagctggcg ctttttccag      6540
     gcgtgcccag cgctccaaaa tcgcgtagac ctcggggttt acgtgctcga ttttcccgcc      6600
     ggcctggtgg ctcggcacat caatgtccag gacaagcacg gctgcgtgct gcgcgtgcgt      6660
     cagagcaaca tactggcacc gggcaagcga ttttgaacca actcggtata acttcggctg      6720
     tgtttctccc gtgtccgggt ctttgatcca agcgctggcg aagtcgcggg tcttgctgcc      6780
     ctggaaattt tctctgccca ggtgagcgag gaattcgcgg cggtcttcgc tcgtccagcc      6840
     acgtgatcgc agcgcgagct cgggatgggt gtcgaacaga tcagcggaaa atttccaggc      6900
     cggtgtgtca atgtctcgtg aatccgctag agtcattttt gagcgctttc tcccaggttt      6960
     ggactggggg ttagccgacg ccctgtgagt taccgctcac ggggcgttca acatttttca      7020
     ggtattcgtg cagcttatcg cttcttgccg cctgtgcgct ttttcgacgc gcgacgctgc      7080
     tgccgattcg gtgcaggtgg tggcggcgct gacacgtcct gggcggccac ggccacacga      7140
     aacgcggcat ttacgatgtt tgtcatgcct gcgggcaccg cgccacgatc gcggataatt      7200
     ctcgctgccg cttccagctc tgtgacgacc atggccaaaa tttcgctcgg gggacgcact      7260
     tccagcgcca tttgcgacct agccgcctcc agctcctcgg cgtggcgttt gttggcgcgc      7320
     tcgcggctgg ctgcggcacg acacgcatct gagcaatatt ttgcgcgccg tcctcgcggg      7380
     tcaggccggg gaggaatcag gccaccgcag taggcgcaac tgattcgatc ctccactact      7440
     gtgcgtcctc ctggcgctgc cgagcacgca gctcgtcagc cagctcctca agatccgcca      7500
     cgagagtttc taggtcgctc gcggcactgg cccagtctcg tgatgctggc gcgtccgtcg      7560
     tatcgagagc tcggaaaaat ccgatcaccg tttttaaatc gacggcagca tcgagcgcgt      7620
     cggactccag cgcgacatca gagagatcca tagctgatga ttcgggccaa ttttggtact      7680
     tcgtcgtgaa ggtcatgaca ccattataac gaacgttcgt taaagttttt ggcggaaaat      7740
     cacgcggcac gaaaattttc acgaagcggg actttgcgca gctcaggggt gctaaaaatt      7800
     ttgtatcgca cttgattttt ccgaaagaca gattatctgc aaacggtgtg tcgtatttct      7860
     ggcttggttt ttaaaaaatc tggaatcgaa aatttgcggg gcgaccgaga agttttttac      7920
     aaaaggcaaa aactttttcg ggatcgacag aaataaaacg atcgacggta cgcaacaaaa      7980
     aagcgtcagg atcgccgtag agcgattgaa gaccgtcaac caaaggggaa gcctccaatc      8040
     gacgcgacgc gcgctctacg gcgatcctga cgcagatttt tagctatctg tcgcagcgcc      8100
     ctcagggaca agccacccgc acaacgtcgc gagggcgatc agcgacgccg caggg           8155
//


spacer
spacer