spacer

EBI Dbfetch

ID   HE583184; SV 1; circular; other DNA; STD; SYN; 10355 BP.
XX
AC   HE583184;
XX
DT   19-AUG-2011 (Rel. 109, Created)
DT   19-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Shuttle vector pSenLys
XX
KW   .
XX
OS   Shuttle vector pSenLys
OC   other sequences; artificial sequences; vectors.
XX
OS   Shuttle vector pEKEx2-Eyfp
OC   other sequences; artificial sequences; vectors.
XX
OS   Corynebacterium glutamicum
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Corynebacterineae; Corynebacteriaceae; Corynebacterium.
XX
OS   Shuttle vector pJC1
OC   other sequences; artificial sequences; vectors.
XX
RN   [1]
RP   1-10355
RA   Binder S.;
RT   ;
RL   Submitted (12-AUG-2011) to the INSDC.
RL   Binder S., Forschungszentrum Juelich GmbH, IBG-1: Biotechnologie,
RL   Leo-Brandt-Str, 52425, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/gb-2012-13-5-r40.
RX   PUBMED; 22640862.
RA   Binder S., Schendzielorz G., Stabler N., Krumbach K., Hoffmann K., Bott M.,
RA   Eggeling L.;
RT   "A high-throughput approach to identify genomic variants of bacterial
RT   metabolite producers at the single-cell level";
RL   Genome Biol. 13(5):R40-R40(2012).
XX
DR   MD5; d61e81be1d405cf953894e4d1e63cc29.
DR   EuropePMC; PMC3446293; 22640862.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10355
FT                   /organism="Shuttle vector pSenLys"
FT                   /focus
FT                   /lab_host="Corynebacterium glutamicum"
FT                   /lab_host="Escherichia coli"
FT                   /mol_type="other DNA"
FT                   /note="L-lysine biosensor"
FT                   /db_xref="taxon:1077180"
FT   source          2502..3226
FT                   /organism="Shuttle vector pEKEx2-Eyfp"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077177"
FT   source          3227..4259
FT                   /organism="Corynebacterium glutamicum"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1718"
FT   source          4260..10355
FT                   /organism="Shuttle vector pJC1"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:1077178"
FT   CDS             complement(2510..3229)
FT                   /transl_table=11
FT                   /gene="eyfp"
FT                   /product="autofluorescent protein"
FT                   /protein_id="CCD28585.1"
FT                   /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
FT                   KFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
FT                   GNYKTRAEVKFEGDTLVNRIELKGINFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
FT                   VNFKIRHNIEGGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
FT                   EFVTAAGITLGMDELYK"
FT   CDS             3387..4259
FT                   /transl_table=11
FT                   /gene="lysG"
FT                   /product="LTTR"
FT                   /protein_id="CCD28586.1"
FT                   /translation="MNPIQLDTLLSIIDEGSFEGASLALSISPSAVSQRVKALEHHVGR
FT                   VLVSRTQPAKATEAGEVLVQAARKMVLLQAETKAQLSGRLAEIPLTIAINADSLSTWFP
FT                   PVFNEVASWGGATLTLRLEDEAHTLSLLRRGDVLGAVTREANPVAGCEVVELGTMRHLA
FT                   IATPSLRDAYMVDGKLDWAAMPVLRFGPKDVLQDRDLDGRVDGPVGRRRVSIVPSAEGF
FT                   GEAIRRGLGWGLLPETQAAPMLKAGEVILLDEIPIDTPMYWQRWRLESRSLARLTDAVV
FT                   DAAIEGLRP"
XX
SQ   Sequence 10355 BP; 2261 A; 2721 C; 2911 G; 2462 T; 0 other;
     ggatcccgag aaaggaaggg aagaaagcga aaggagcggg cgctagggcg ctggcaagtg        60
     tagcggtcac gctgcgcgta accaccacac ccgccgcgct taatgcgccg ctacagggcg       120
     cgtcccattc gccaatccgg atatagttcc tcctttcagc aaaaaacccc tcaagacccg       180
     tttagaggcc ccaaggggtt atgctagtta ttgctcagcg gtggcagcag ccaactcagc       240
     ttcctttcgg gctttgttag cagccggatc tcagtgggaa ttcctactgg aacaggtggt       300
     ggcgggcctc ggcgcgctcg tactgctcca ccacggtgta gtcctcgttg tgggaggtga       360
     tgtcgagctt gtagtccacg tagtggtagc cgggcagctt cacgggcttc ttggccatgt       420
     agatggactt gaactcacac aggtagtggc cgccgccctt cagcttcagc gccatgtggt       480
     tctcgccctt cagcacgccg tcgcgggggt agttgcgctc agtggagggc tcccagccca       540
     gagtcttctt ctgcattacg gggccgtcgg aggggaagtt cacgccgatg aacttcacgt       600
     ggtagatgag ggtgccgtcc tgcagggagg agtcctgggt cacggtcacc acgccgccgt       660
     cctcgaagtt catcacgcgc tcccacttga agccctcggg gaaggactgc ttgaggtagt       720
     cggggatgtc ggcggggtgc ttgatgtacg ccttggagcc gtagaagaac tggggggaca       780
     ggatgtccca ggcgaagggc agggggccgc ccttggtcac ttgcagcttg gcggtctggg       840
     tgccctcgta gggcttgccc tcgcccacgc cctcgatctc gaactcgtgg ccgttcacgg       900
     agccctccat gtgcaccttg aagcgcatga agggcttgat gacgttctca gtgctatcca       960
     tatgtatatc tccttctgca ggcatgcaag cttggcgtaa tcatggtcat atcttttaat      1020
     tctgtttcct gtgtgaaatt gttatccgct cacaattcca cacattatac gagccgatga      1080
     ttaattgtca acagctcatt tcagaatatt tgccagaacc gttatgatgt cggcgcaaaa      1140
     aacattatcc agaacgggag tgcgccttga gcgacacgaa ttatgcagtg atttacgacc      1200
     tgcacagcca taccacagct tccgatggct gcctgacgcc agaagcattg gtgcaccgtg      1260
     cagtcgataa gcccggatca gcttgcaatt cgcgcgcgaa ggcgaagcgg catgcattta      1320
     cgttgacacc atcgaatggt gcaaaacctt tcgcggtatg gcatgatagc gcccggaaga      1380
     gagtcaattc agggtggtga atgtgaaacc agtaacgtta tacgatgtcg cagagtatgc      1440
     cggtgtctct tatcagaccg tttcccgcgt ggtgaaccag gccagccacg tttctgcgaa      1500
     aacgcgggaa aaagtggaag cggcgatggc ggagctgaat tacattccca accgcgtggc      1560
     acaacaactg gcgggcaaac agtcgttgct gattggcgtt gccacctcca gtctggccct      1620
     gcacgcgccg tcgcaaattg tcgcggcgat taaatctcgc gccgatcaac tgggtgccag      1680
     cgtggtggtg tcgatggtag aacgaagcgg cgtcgaagcc tgtaaagcgg cggtgcacaa      1740
     tcttctcgcg caacgcgtca gtgggctgat cattaactat ccgctggatg accaggatgc      1800
     cattgctgtg gaagctgcct gcactaatgt tccggcgtta tttcttgatg tctctgacca      1860
     gacacccatc aacagtatta ttttctccca tgaagacggt acgcgactgg gcgtggagca      1920
     tctggtcgca ttgggtcacc agcaaatcgc gctgttagcg ggcccattaa gttctgtctc      1980
     ggcgcgtctg cgtctggctg gctggcataa atatctcact cgcaatcaaa ttcagccgat      2040
     agcggaacgg gaaggcgact ggagtgccat gtccggtttt caacaaacca tgcaaatgct      2100
     gaatgagggc atcgttccca ctgcgatgct ggttgccaac gatcagatgg cgctgggcgc      2160
     aatgcgcgcc attaccgagt ccgggctgcg cgttggtgcg gatatctcgg tagtgggata      2220
     cgacgatacc gaagacagct catgttatat cccgccgtta accaccatca aacaggattt      2280
     tcgcctgctg gggcaaacca gcgtggaccg cttgctgcaa ctctctcagg gccaggcggt      2340
     gaagggcaat cagctgttgc ccgtctcact ggtgaaaaga aaaaccaccc tggcgcccaa      2400
     tacgcaaacc gcctctcccc gcgcgtcggc cgccatgccg gcgataatgg cctgcttctc      2460
     gccgaaacgt ttggtggcgg gaccagtgac gaaggcttga ggatccttat tacttgtaca      2520
     gctcgtccat gccgagagtg atcccggcgg cggtcacgaa ctccagcagg accatgtgat      2580
     cgcgcttctc gttggggtct ttgctcaggg cggactggta gctcaggtag tggttgtcgg      2640
     gcagcagcac ggggccgtcg ccgatggggg tgttctgctg gtagtggtcg gcgagctgca      2700
     cgctgccgcc ctcgatgttg tggcggatct tgaagttcac cttgatgccg ttcttctgct      2760
     tgtcggccat gatatagacg ttgtggctgt tgtagttgta ctccagcttg tgccccagga      2820
     tgttgccgtc ctccttgaag ttgatgccct tcagctcgat gcggttcacc agggtgtcgc      2880
     cctcgaactt cacctcggcg cgggtcttgt agttgccgtc gtccttgaag aagatggtgc      2940
     gctcctggac gtagccttcg ggcatggcgg acttgaagaa gtcgtgctgc ttcatgtggt      3000
     cggggtagcg ggcgaagcac tgcaggccgt agccgaaggt ggtcacgagg gtgggccagg      3060
     gcacgggcag cttgccggtg gtgcagatga acttcagggt cagcttgccg taggtggcat      3120
     cgccctcgcc ctcgccggac acgctgaact tgtggccgtt tacgtcgccg tccagctcga      3180
     ccaggatggg caccaccccg gtgaacagct cctcgccctt gctcaccata tgatatctcc      3240
     ttcttaaagt tcatctaggt ccgatggaca gtaaaagact ggcccccaaa agcagacctg      3300
     taatgaagat ttccatgatc accatcgtga cctatggaag tacttaagta aaatgattgg      3360
     ttcttaacat ggtttaatat agcttcatga accccattca actggacact ttgctctcaa      3420
     tcattgatga aggcagcttc gaaggcgcct ccttagccct ttccatttcc ccctcggcgg      3480
     tgagtcagcg cgttaaagct ctcgagcatc acgtgggtcg agtgttggta tcgcgcaccc      3540
     aaccggccaa agcaaccgaa gcgggtgaag tccttgtgca agcagcgcgg aaaatggtgt      3600
     tgctgcaagc agaaactaaa gcgcaactat ctggacgcct tgctgaaatc ccgttaacca      3660
     tcgccatcaa cgcagattcg ctatccacat ggtttcctcc cgtgttcaac gaggtagctt      3720
     cttggggtgg agcaacgctc acgctgcgct tggaagatga agcgcacaca ttatccttgc      3780
     tgcggcgtgg agatgtttta ggagcggtaa cccgtgaagc taatcccgtg gcgggatgtg      3840
     aagtagtaga acttggaacc atgcgccact tggccattgc aaccccctca ttgcgggatg      3900
     cctacatggt tgatgggaaa ctagattggg ctgcgatgcc cgtcttacgc ttcggtccca      3960
     aagatgtgct tcaagaccgt gacctggacg ggcgcgtcga tggtcctgtg gggcgcaggc      4020
     gcgtatccat tgtcccgtcg gcggaaggtt ttggtgaggc aattcgccga ggccttggtt      4080
     ggggacttct tcccgaaacc caagctgctc ccatgctaaa agcaggagaa gtgatcctcc      4140
     tcgatgagat acccattgac acaccgatgt attggcaacg atggcgcctg gaatctagat      4200
     ctctagctag actcacagac gccgtcgttg atgcagcaat cgagggattg cggccttagg      4260
     tcgacctgca gcaatggcaa caacgttgcg caaactatta actggcgaac tacttactct      4320
     agcttcccgg caacaattaa tagactggat ggaggcggat aaagttgcag gaccacttct      4380
     gcgctcggcc cttccggctg gctggtttat tgctgataaa tctggagccg gtgagcgtgg      4440
     gtctcgcggt atcattgcag cactggggcc agatggtaag ccctcccgta tcgtagttat      4500
     ctacacgacg gggagtcagg caactatgga tgaacgaaat agacagatcg ctgagatagg      4560
     tgcctcactg attaagcatt ggtaactgtc agaccaagtt tactcatata tactttagat      4620
     tgatttaaaa cttcattttt aatttaaaag gatctaggtg aagatccttt ttgataatct      4680
     catgaccaaa atcccttaac gtgagttttc gttccactga gcgtcagacc ccttaataag      4740
     atgatcttct tgagatcgtt ttggtctgcg cgtaatctct tgctctgaaa acgaaaaaac      4800
     cgccttgcag ggcggttttt cgaaggttct ctgagctacc aactctttga accgaggtaa      4860
     ctggcttgga ggagcgcagt caccaaaact tgtcctttca gtttagcctt aaccggcgca      4920
     tgacttcaag actaactcct ctaaatcaat taccagtggc tgctgccagt ggtgcttttg      4980
     catgtctttc cgggttggac tcaagacgat agttaccgga taaggcgcag cggtcggact      5040
     gaacgggggg ttcgtgcata cagtccagct tggagcgaac tgcctacccg gaactgagtg      5100
     tcaggcgtgg aatgagacaa acgcggccat aacagcggaa tgacaccggt aaaccgaaag      5160
     gcaggaacag gagagcgcac gagggagccg ccagggggaa acgcctggta tctttatagt      5220
     cctgtcgggt ttcgccacca ctgatttgag cgtcagattt cgtgatgctt gtcagggggg      5280
     cggagcctat ggaaaaacgg ctttgccgcg gccctctcac ttccctgtta agtatcttcc      5340
     tggcatcttc caggaaatct ccgccccgtt cgtaagccat ttccgctcgc cgcagtcgaa      5400
     cgaccgagcg tagcgagtca gtgagcgagg aagcggaata tatcctgtat cacatattct      5460
     gctgacgcac cggtgcagcc ttttttctcc tgccacatga agcacttcac tgacaccctc      5520
     atcagtgcca acatagtaag ccagtataca ctccgctagc gctgaggtct gcctcgtgaa      5580
     gaaggtgttg ctgactcata ccaggcctga atcgccccat catccagcca gaaagtgagg      5640
     gagccacggt tgatgagagc tttgttgtag gtggaccagt tggtgatttt gaacttttgc      5700
     tttgccacgg aacggtctgc gttgtcggga agatgcgtga tctgatcctt caactcagca      5760
     aaagttcgat ttattcaaca aagccacgtt gtgtctcaaa atctctgatg ttacattgca      5820
     caagataaaa atatatcatc atgaacaata aaactgtctg cttacataaa cagtaataca      5880
     aggggtgtta tgagccatat tcaacgggaa acgtcttgct cgaggccgcg attaaattcc      5940
     aacatggatg ctgatttata tgggtataaa tgggctcgcg ataatgtcgg gcaatcaggt      6000
     gcgacaatct atcgattgta tgggaagccc gatgcgccag agttgtttct gaaacatggc      6060
     aaaggtagcg ttgccaatga tgttacagat gagatggtca gactaaactg gctgacggaa      6120
     tttatgcctc ttccgaccat caagcatttt atccgtactc ctgatgatgc atggttactc      6180
     accactgcga tccccgggaa aacagcattc caggtattag aagaatatcc tgattcaggt      6240
     gaaaatattg ttgatgcgct ggcagtgttc ctgcgccggt tgcattcgat tcctgtttgt      6300
     aattgtcctt ttaacagcga tcgcgtattt cgtctcgctc aggcgcaatc acgaatgaat      6360
     aacggtttgg ttgatgcgag tgattttgat gacgagcgta atggctggcc tgttgaacaa      6420
     gtctggaaag aaatgcataa gcttttgcca ttctcaccgg attcagtcgt cactcatggt      6480
     gatttctcac ttgataacct tatttttgac gaggggaaat taataggttg tattgatgtt      6540
     ggacgagtcg gaatcgcaga ccgataccag gatcttgcca tcctatggaa ctgcctcggt      6600
     gagttttctc cttcattaca gaaacggctt tttcaaaaat atggtattga taatcctgat      6660
     atgaataaat tgcagtttca tttgatgctc gatgagtttt tctaatcaga attggttaat      6720
     tggttgtaac actggcagag cattacgctg acttgacggg acggcggctt tgttgaataa      6780
     atcgaacttt tgctgagttg aaggatcaga tcacgcatct tcccgacaac gcagaccgtt      6840
     ccgtggcaaa gcaaaagttc aaaatcacca actggtccac ctacaacaaa gctctcatca      6900
     accgtggctc cctcactttc tggctggatg atggggcgat tcaggcctgg tatgagtcag      6960
     caacaccttc ttcacgaggc agacctcagc gctcaaagat gcaggggtaa aagctaaccg      7020
     catctttacc gacaaggcat ccggcagttc aacagatcgg gaagggctgg atttgctgag      7080
     gatgaaggtg gaggaaggtg atgtcattct ggtgaagaag ctcgaccgtc ttggccgcga      7140
     caccgccgac atgatccaac tgataaaaga gtttgatgct cagggtgtag cggttcggtt      7200
     tattgacgac gggatcagta ccgacggtga tatggggcaa atggtggtca ccatcctgtc      7260
     ggctgtggca caggctgaac gccggaggat caagtcggtc aagccaagcg caaccagcgg      7320
     caccgccgcg agcaacgtcg caagggcgat caggggacga tttttgcgaa gaatttccac      7380
     ggtaagaatc caatctctcg aatttagggt gaaagaagct tggcataggg gtgtgcacga      7440
     actcggtgga ggaaatttcc gcggggcaag gcttcgcgaa gcggagtcgc ggcagtggct      7500
     ttgaagatct ttgggagcag tccttgtgcg cttacgaggt gagccggtgg ggaaccgtta      7560
     tctgcctatg gtgtgagccc ccctagagag cttcaagagc aatcagcccg acctagaaag      7620
     gaggccaaga gagagacccc tacgggggga accgttttct gcctacgaga tggcacattt      7680
     actgggaagc tttacggcgt cctcgtggaa gttcaatgcc cgcagactta agtgctctat      7740
     tcacggtctg acgtgacacg ctaaattcag acatagcttc attgattgtc ggccacgagc      7800
     cagtctctcc ctcaacagtc ataaaccaac ctgcaatggt caagcgattt cctttagctt      7860
     tcctagcttg tcgttgactg gacttagcta gtttttctcg ctgtgctcgg gcgtactcac      7920
     tgtttgggtc tttccagcgt tctgcggcct ttttaccgcc acgtcttccc atagtggcca      7980
     gagcttttcg ccctcggctg ctctgcgtct ctgtctgacg agcagggacg actggctggc      8040
     ctttagcgac gtagccgcgc acacgtcgcg ccatcgtctg gcggtcacgc atcggcggca      8100
     gatcaggctc acggccgtct gctccgaccg cctgagcgac ggtgtaggca cgctcgtagg      8160
     cgtcgatgat cttggtgtct tttaggcgct caccagccgc ttttaactgg tatcccacag      8220
     tcaaagcgtg gcgaaaagcc gtctcatcac gggcggcacg ccctggagca gtccagagga      8280
     cacggacgcc gtcgatcagc tctccagacg cttcagcggc gctcggcagg cttgcttcaa      8340
     gcgtggcaag tgcttttgct tccgcagtgg cttttcttgc cgcttcgata cgtgcccgtc      8400
     cgctagaaaa ctcctgctca tagcgttttt taggtttttc tgtgcctgag atcatgcgag      8460
     caacctccat aagatcagct aggcgatcca cgcgattgtg ctgggcatgc cagcggtacg      8520
     cggtgggatc gtcggagacg tgcagtggcc accggctcag cctatgtgaa aaagcctggt      8580
     cagcgccgaa aacgcgggtc atttcctcgg tcgttgcagc cagcaggcgc atattcgggc      8640
     tgctcatgcc tgctgcggca tacaccggat caatgagcca gatgagctgg catttcccgc      8700
     tcagtggatt cacgccgatc caagctggcg ctttttccag gcgtgcccag cgctccaaaa      8760
     tcgcgtagac ctcggggttt acgtgctcga ttttcccgcc ggcctggtgg ctcggcacat      8820
     caatgtccag gacaagcacg gctgcgtgct gcgcgtgcgt cagagcaaca tactggcacc      8880
     gggcaagcga ttttgaacca actcggtata acttcggctg tgtttctccc gtgtccgggt      8940
     ctttgatcca agcgctggcg aagtcgcggg tcttgctgcc ctggaaattt tctctgccca      9000
     ggtgagcgag gaattcgcgg cggtcttcgc tcgtccagcc acgtgatcgc agcgcgagct      9060
     cgggatgggt gtcgaacaga tcagcggaaa atttccaggc cggtgtgtca atgtctcgtg      9120
     aatccgctag agtcattttt gagcgctttc tcccaggttt ggactggggg ttagccgacg      9180
     ccctgtgagt taccgctcac ggggcgttca acatttttca ggtattcgtg cagcttatcg      9240
     cttcttgccg cctgtgcgct ttttcgacgc gcgacgctgc tgccgattcg gtgcaggtgg      9300
     tggcggcgct gacacgtcct gggcggccac ggccacacga aacgcggcat ttacgatgtt      9360
     tgtcatgcct gcgggcaccg cgccacgatc gcggataatt ctcgctgccg cttccagctc      9420
     tgtgacgacc atggccaaaa tttcgctcgg gggacgcact tccagcgcca tttgcgacct      9480
     agccgcctcc agctcctcgg cgtggcgttt gttggcgcgc tcgcggctgg ctgcggcacg      9540
     acacgcatct gagcaatatt ttgcgcgccg tcctcgcggg tcaggccggg gaggaatcag      9600
     gccaccgcag taggcgcaac tgattcgatc ctccactact gtgcgtcctc ctggcgctgc      9660
     cgagcacgca gctcgtcagc cagctcctca agatccgcca cgagagtttc taggtcgctc      9720
     gcggcactgg cccagtctcg tgatgctggc gcgtccgtcg tatcgagagc tcggaaaaat      9780
     ccgatcaccg tttttaaatc gacggcagca tcgagcgcgt cggactccag cgcgacatca      9840
     gagagatcca tagctgatga ttcgggccaa ttttggtact tcgtcgtgaa ggtcatgaca      9900
     ccattataac gaacgttcgt taaagttttt ggcggaaaat cacgcggcac gaaaattttc      9960
     acgaagcggg actttgcgca gctcaggggt gctaaaaatt ttgtatcgca cttgattttt     10020
     ccgaaagaca gattatctgc aaacggtgtg tcgtatttct ggcttggttt ttaaaaaatc     10080
     tggaatcgaa aatttgcggg gcgaccgaga agttttttac aaaaggcaaa aactttttcg     10140
     ggatcgacag aaataaaacg atcgacggta cgcaacaaaa aagcgtcagg atcgccgtag     10200
     agcgattgaa gaccgtcaac caaaggggaa gcctccaatc gacgcgacgc gcgctctacg     10260
     gcgatcctga cgcagatttt tagctatctg tcgcagcgcc ctcagggaca agccacccgc     10320
     acaacgtcgc gagggcgatc agcgacgccg caggg                                10355
//


spacer
spacer