spacer

EBI Dbfetch

ID   GU991557; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU991557;
XX
DT   03-MAY-2010 (Rel. 104, Created)
DT   03-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1349
DE   unconfirmed allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   "Novel HLA-Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   ;
RL   Submitted (11-MAR-2010) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 0b7f8f1e4e6f4669b182a641bfdb25a4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1349 unconfirmed"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1349 unconfirmed"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1349 unconfirmed"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D6PZZ5"
FT                   /db_xref="IMGT/HLA:DRB1*13:49"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D6PZZ5"
FT                   /protein_id="ADF58797.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1349 unconfirmed"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 65 C; 96 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer