spacer

EBI Dbfetch

ID   GU812303; SV 1; linear; genomic DNA; STD; HUM; 3714 BP.
XX
AC   GU812303;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*550201 allele,
DE   promoter region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3714
RA   Xu Y.P., Deng Z.H., Yang B.C.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-3714
RA   Xu Y.P., Deng Z.H., Yang B.C.;
RT   ;
RL   Submitted (12-FEB-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 01f1513d2997fff26eb8b0e2b9bc3f81.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3714
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: ccagttcarggacagggattc, rev_seq:
FT                   aacagactcagcacagcraac"
FT                   /db_xref="taxon:9606"
FT   gene            1..3714
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201"
FT   misc_feature    1..410
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<411..483,612..881,1127..1402,1978..2253,2358..2474,
FT                   2916..2948,3055..3714)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201"
FT                   /product="MHC class I antigen"
FT   CDS             join(411..483,612..881,1127..1402,1978..2253,2358..2474,
FT                   2916..2948,3055..3098)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:C6K6J4"
FT                   /db_xref="IMGT/HLA:B*55:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6K6J4"
FT                   /protein_id="ADE80894.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   3'UTR           3099..3714
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201"
XX
SQ   Sequence 3714 BP; 715 A; 1041 C; 1156 G; 802 T; 0 other;
     caggaggaga agtgaagggg aagcgggtgg gcgcagcctg ggggtctctc cctggtttcc        60
     acagacagat ccttgtgcag gactcaggca gacagtgtga caaagaggct ggtgtaggag       120
     aagagggatc aggacgaagt cccatgtccc ggacggggct ctcagggtct caggctccga       180
     gggccgcgtc tgcattgggg aggcgcagcg ttggggattc cccactccca cgagtttcac       240
     ttcttctccc aacctatgtc gggtccttct tccaggatac tcgtgacgcg tccccatttc       300
     ccactcccat tgggtgtcgg gtgtctagag aagccaatca gtgtcgccgg ggtcccagtt       360
     ctaaagtccc cacgcaccca cccggactca gagtctcctc agacaccgag atgcgggtca       420
     cggcaccccg aaccctcctc ctgctgctct ggggggccct ggccctgacc gagacctggg       480
     ccggtgagtg cgggtcggga gggaaatggc ctctgtgggg aggagcgagg ggaccgcagg       540
     cgggggcgca ggacccgggg agccgcgccg ggaggagggt ctggcgggtc tcagcccctc       600
     ctcgccccca ggctcccact ccatgaggta tttctacacc gccatgtccc ggcccggccg       660
     cggggagccc cgcttcatcg cagtgggcta cgtggacgac acgcagttcg tgaggttcga       720
     cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc aggaggggcc       780
     ggagtattgg gaccggaaca cacagatcta caaggcccag gcacagactg accgagagag       840
     cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       900
     ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga gtctccgggt       960
     ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg cgagagcccc      1020
     aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg ttggtcgggg      1080
     cggggcgggg ctcgggggac ggggctgacc gcggggccgg ggccagggtc tcacacttgg      1140
     cagacgatgt atggctgcga cctggggccg gacgggcgcc tcctccgcgg gcataaccag      1200
     ttagcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg      1260
     gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag      1320
     ctgagagcct acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg      1380
     aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc atctcctata      1440
     ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg ctagaatgtc      1500
     gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag ggccccctct      1560
     tctctctagg acaattaagg gatgacgtct ctgaggaaat ggaggggaag acagtcccta      1620
     gaatactgat caggggtcct ctttgacccc tgcagcagcc ttgggaaccg tgacttttcc      1680
     tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt ccagcacttc      1740
     tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg ctcagagact      1800
     cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg gtgtctgggt      1860
     tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca catgggtggt      1920
     cctagggtgt cctatgagag atgcaaagcg cctgaatttt ctgactcttc ccatcagacc      1980
     ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc ctgaggtgct      2040
     gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc      2100
     aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc ttccagaagt      2160
     gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat gtacagcatg      2220
     aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag gggtcatatc      2280
     tcttctcagg gaaagcagga gcccttctgg agcccttcag cagggtcagg gcccctcgtc      2340
     ttcccctcct ttcccagagc catcttccca gtccaccatc cccatcgtgg gcattgttgc      2400
     tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctactg tgatgtgtag      2460
     gaggaagagc tcaggtaggg aaggggtgag gggtggggtc tgggttttct tgtcccactg      2520
     ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt actgggaagc agcatccaca      2580
     caggggctaa tgcagcctgg gaccctgtgt gccagcactt actcttttgt gcagcacatg      2640
     tgacaatgaa ggacggatgt atcaccttga tggttgtggt gttggggtcc tgatttcagc      2700
     attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca gttggtccag      2760
     gacccacact tgctttcctc gtgtttcctg atcctgcctt gggtctgtag tcatacttct      2820
     ggaaattcct tttgggtcca agacgaggag gttcctctaa gatctcatgg ccctgcttcc      2880
     tcccagtccc ctcacaggac attttcttcc cacaggtgga aaaggaggga gctactctca      2940
     ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct cacccacccc ataattcctc      3000
     ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt ttgttctact ccagccagcg      3060
     acagtgccca gggctctgat gtgtctctca cagcttgaaa aggtgagatt cttggggtct      3120
     agagtgggcg ggggggggtg gggtggggag ggggcagagg gggaaaggcc tgggtaatgg      3180
     agattctttg attgggatgt ttcgcgtgtg tggtgggctg tttagagtgt catcacttac      3240
     catgactaac cagaatttgt tcatgactgt tgttttctgt agcctgagac agctgtcttg      3300
     tgagggactg agatgcagga tttcttcact cctccccttt gtgacttcaa gagcctctgg      3360
     catctctttc tgcaaaggca cctgaatgtg tctgcgtccc tgttagcata atgtgaggag      3420
     gtggagagac agcccacccc cgtgtccact gtgacccctg ttcccatgct gacctgtgtt      3480
     tcctccccag tcatctttcc tgttccagag gggtggggct ggatgtctcc atctctgtct      3540
     caactttatg tgcactgagc tgcaacttct tacttcccta ctgaaaataa gaatctgaat      3600
     ataaatttgt tttctcaaat atttgctatg agaggttgat ggattaatta aataagtcaa      3660
     ttcctggaat gtgagagagc aaataaagac ctgagaactt tccagaatct gcat            3714
//


spacer
spacer