spacer

EBI Dbfetch

ID   GU812302; SV 1; linear; genomic DNA; STD; HUM; 3708 BP.
XX
AC   GU812302;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*510101 allele,
DE   promoter region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3708
RA   Xu Y.P., Deng Z.H., Yang B.C.;
RT   "Characterization and polymorphism analyses of HLA-B genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-3708
RA   Xu Y.P., Deng Z.H., Yang B.C.;
RT   ;
RL   Submitted (12-FEB-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 2647d6adc486c383c02a865fbbb6039c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3708
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: ccagttcarggacagggattc, rev_seq:
FT                   aacagactcagcacagcraac"
FT                   /db_xref="taxon:9606"
FT   gene            1..3708
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510101"
FT   misc_feature    1..410
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510101"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<411..483,613..882,1128..1403,1979..2254,2359..2475,
FT                   2917..2949,3056..3708)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510101"
FT                   /product="MHC class I antigen"
FT   CDS             join(411..483,613..882,1128..1403,1979..2254,2359..2475,
FT                   2917..2949,3056..3099)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510101"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:Q546B1"
FT                   /db_xref="IMGT/HLA:B*51:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546B1"
FT                   /protein_id="ADE80893.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   3'UTR           3100..3708
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510101"
XX
SQ   Sequence 3708 BP; 721 A; 1044 C; 1141 G; 802 T; 0 other;
     caggaggaga agtgaagggg aagcgggtgg gcgcagcctg ggggtctctc cctggtttcc        60
     acagacagat ccttgtgcag gactcaggca gacagtgtga caaagaggct ggtgtaggag       120
     aagagggatc aggacgaagt cccaggcccc gggcggggct ctcagggtct caggctccga       180
     gagccttgtc tgcattgggg aggcgcagcg ttggggattc cccactccca cgagtttcac       240
     ttcttctccc aacctatgtc gggtccttct tccaggatac tcgtgacgcg tccccatttc       300
     ccactcccat tgggtgtcgg atatctagag aagccaatca gtgtcgccgg ggtcccagtt       360
     ctaaagtccc cacgcaccca cccggactca gaatctcctc agacgccgag atgcgggtca       420
     cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc gagacctggg       480
     ccggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagcgag gggaccgcag       540
     gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct       600
     cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc       660
     gcggggagcc ccgcttcatt gcagtgggct acgtggacga cacccagttc gtgaggttcg       720
     acagcgacgc cgcgagtccg aggacggagc cccgggcgcc atggatagag caggaggggc       780
     cggagtattg ggaccggaac acacagatct tcaagaccaa cacacagact taccgagaga       840
     acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga ccccggcccg       900
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       960
     tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg gcgagagccc      1020
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg      1080
     gcggggcggg gctcggggga cggtgctgac cgcggggccg gggccagggt ctcacacttg      1140
     gcagacgatg tatggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcataacca      1200
     gtacgcctac gacggcaaag attacatcgc cctgaacgag gacctgagct cctggaccgc      1260
     ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca      1320
     gctgagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagacacc tggagaacgg      1380
     gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcctat      1440
     aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt      1500
     cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc      1560
     ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa gacagtccct      1620
     agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc gtgacttttc      1680
     ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat tccagcactt      1740
     ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc gctcagagac      1800
     tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct ggtgtctggg      1860
     ttctgtgccc cttccccaca ccaggtgtcc tgtccattct caggctggtc acatgggtgg      1920
     tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt cccatcagac      1980
     cccccaaaga cacacgtgac ccaccacccc gtctctgacc atgaggccac cctgaggtgc      2040
     tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga tggcgaggac      2100
     caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac cttccagaag      2160
     tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca tgtacagcat      2220
     gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga ggggtcatat      2280
     ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag ggcccctcgt      2340
     cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg ggcattgttg      2400
     ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact gtgatgtgta      2460
     ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc ttgtcccact      2520
     gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag cagcatccac      2580
     acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg tgcagcacat      2640
     gtgacaatga aggacggatg tatcaccttg atggttgtgg tgttggggtc ctgatttcag      2700
     cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca      2760
     ggacccacac ttgctttcct cgtgtttcct gatcctgcct tgggtctgta gtcatacttc      2820
     tggaaattcc ttttgggtcc aagacgagga ggttcctcta agatctcatg gccctgcttc      2880
     ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg agctactctc      2940
     aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc cataattcct      3000
     cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac tccagccagc      3060
     gacagtgccc agggctctga tgtgtctctc acagcttgaa aaggtgagat tcttggggtc      3120
     tagagtgggc ggggggggcg gggagggggc agaggggaaa ggcctgggta atggagattc      3180
     tttgattggg atgtttcgcg tgtgtcgtgg gctgttcaga gtgtcatcac ttaccatgac      3240
     taaccagaat ttgttcatga ctgttgtttt ctgtagcctg agacagctgt cttgtgaggg      3300
     actgagatgc aggatttctt cactcctccc ctttgtgact tcaagagcct ctggcatctc      3360
     tttctgcaaa ggcacctgaa tgtgtctgcg ttcctgttag cataatgtga ggaggtggag      3420
     agacagccca cccttgtgtc cactgtgacc cctgttccca tgctgacctg tgtttcctcc      3480
     ccagtcatct ttcttgttcc agagaggtgg ggctggatgt ctccatctct gtctcaactt      3540
     tatgtgcact gagctgcaac ttcttacttc cctactgaaa ataagaatct gaatatacat      3600
     ttgttttctc aaatatttgc tatgagaggt tgatggatta attaaataag tcaattcctg      3660
     gaatgtgaga gagcaaataa agacctgaga accttccaga atctgcat                   3708
//


spacer
spacer