spacer

EBI Dbfetch

ID   GU812300; SV 1; linear; genomic DNA; STD; HUM; 3705 BP.
XX
AC   GU812300;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*400102 allele,
DE   promoter region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3705
RA   Xu Y.P., Deng Z.H., Yang B.C.;
RT   "Characterization and polymorphism analyses of HLA-B genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-3705
RA   Xu Y.P., Deng Z.H., Yang B.C.;
RT   ;
RL   Submitted (12-FEB-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 9c232242f46b75c6a6fd1dc93794b4fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3705
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: ccagttcarggacagggattc, rev_seq:
FT                   aacagactcagcacagcraac"
FT                   /db_xref="taxon:9606"
FT   gene            1..3705
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102"
FT   misc_feature    1..411
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<412..484,613..882,1128..1403,1978..2253,2347..2463,
FT                   2905..2937,3044..3705)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102"
FT                   /product="MHC class I antigen"
FT   CDS             join(412..484,613..882,1128..1403,1978..2253,2347..2463,
FT                   2905..2937,3044..3087)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:C6K6H8"
FT                   /db_xref="IMGT/HLA:B*40:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6K6H8"
FT                   /protein_id="ADE80891.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   3'UTR           3088..3705
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102"
XX
SQ   Sequence 3705 BP; 716 A; 1042 C; 1145 G; 802 T; 0 other;
     caggaggaga agtgaagggg aagcgggtga gcgcagcctg ggggtctctc cctggtttcc        60
     acagacagat ccttgtgcag gactcaggca gacagtgtga caaagaggct tggtgtagga       120
     gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc tcaggctccg       180
     agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc acgagtttca       240
     cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc gtccccattt       300
     cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agcgtcgccg tggtcccagt       360
     tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga gatgcgggtc       420
     acggcacccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac cgagacctgg       480
     gccggtgagt gcgggtcggc agggaaatgg cctctgtggg gaggagcgag gggaccgcag       540
     gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt ctcagctcct       600
     cctcgccccc aggctcccac tccatgaggt atttccacac cgccatgtcc cggcccggcc       660
     gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc gtgaggttcg       720
     acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag caggaggggc       780
     cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact taccgagaga       840
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       900
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       960
     tccgagatcc gaccccctga ggccgcggga cccgcccaga ccctcgaccg gcgagagccc      1020
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg      1080
     gcggggcggg gctcggggga ctgggctgac cgcggggccg gggccagggt ctcacaccct      1140
     ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcataacca      1200
     gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc      1260
     cgcggacacg gcggctcaga tctcccagcg caagttggag gcggcccgtg tggcggagca      1320
     gctgagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc tggagaacgg      1380
     gaaggacaag ctggagcgcg ctggtaccag gggcagtggg gagccttccc catctcctat      1440
     aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt      1500
     cgccctccgt tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc      1560
     ttctctctag acaattaagg aatgacgtct ctgaggaaat ggaggggaag acagtcccta      1620
     gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg tgacttttcc      1680
     tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt ccagcacttc      1740
     tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg ctcagagact      1800
     cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg gtgtctgggt      1860
     tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca catgggtggt      1920
     cctagggtgt cccatgaaag atgcaaagcg cctgaatttt ctgactcttc ccatcagacc      1980
     ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc ctgaggtgct      2040
     gggccctggg tttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc      2100
     aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc ttccagaagt      2160
     gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat gtacagcatg      2220
     aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag gggtcatatc      2280
     tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct tcccctcctt      2340
     tcccagagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct ggcctggctg      2400
     tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg aggaagagtt      2460
     caggtaggga aggggtgagg ggtggggtct gggttttctt gtcccactgg gggtttcaag      2520
     ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatgcacac aggggctaac      2580
     gcagcctggg accctgtgtg ccagcactta ctcttttgtg cagcacatgt gacaatgaag      2640
     gatggatgta tcaccttgat ggttgtggtg ttggggtcct gattccagca ttcatgagtc      2700
     aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg acccacactt      2760
     gctttcctcg tgtttcctga tcctgccctg ggtctgtagt catacttctg gaaattcctt      2820
     ttgggtccaa gactaggagg ttcctctaag atctcatggc cctgcttcct cccagtgccc      2880
     tcacaggaca ttttcttccc acaggtggaa aaggagggag ctactctcag gctgcgtgta      2940
     agtggtgggg gtgggagtgt ggaggagctc acccacccca taattcctcc tgtcccacgt      3000
     ctcctgcggg ctctgaccag gtcctgtttt tgttctactc caggcagcga cagtgcccag      3060
     ggctctgatg tgtctctcac agcttgaaaa ggtgagattc ttggggtcta gagtgggtgg      3120
     ggtggcgggt ctgggggtgg gtggggcaga ggggaaaggc ctgggtaatg gggattcttt      3180
     gattgggatg tttcgcgtgt gtggtgggct gtttagagtg tcatcgctta ccatgactaa      3240
     ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt gtgagggact      3300
     gagatgcagg atttcttcac gcctcccctt tgtgacttca agagcctctg gcatctcttt      3360
     ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga ggtggagaga      3420
     cagcccaccc ttgtgtccac tgtgacccct gttcccatgc tgacctgtgt ttcctcccca      3480
     gtcatctttc ttgttccaga gaggtggggc tggatgtctc catctctgtc tcaactttac      3540
     gtgcactgag ctgcaacttc ttacttccct actgaaaata agaatctgaa tataaatttg      3600
     ttttctcaaa tatttgctat gagaggttga tggattaatt aaataagtca attcctggaa      3660
     tttgaaagag caaataaaga cctgagaacc ttccagaatc tgcat                      3705
//


spacer
spacer