spacer

EBI Dbfetch

ID   GU809990; SV 1; linear; genomic DNA; STD; HUM; 1654 BP.
XX
AC   GU809990;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   19-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*03 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1654
RX   DOI; 10.1111/j.1399-0039.2010.01555.x.
RX   PUBMED; 20727113.
RA   Shen M., Chan S.H., Ren E.C.;
RT   "Identification of a novel HLA-C allele, HLA-C*03:85, in a Singaporean
RT   Chinese";
RL   Tissue Antigens 77(1):83-84(2011).
XX
RN   [2]
RP   1-1654
RA   Shen M., Chan S.H., Ren E.C.;
RT   ;
RL   Submitted (17-FEB-2010) to the INSDC.
RL   Yong Loo Lin School of Medicine, National University of Singapore,
RL   Immunology Centre, 5 Science Drive 2, MD4, Level 5, Singapore 117597,
RL   Singapore
XX
DR   MD5; 161d75416781dee5f3582bea7a815232.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1654
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1654
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 variant"
FT   mRNA            join(<1..270,517..792,1379..>1654)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1379..>1654)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D5L7X0"
FT                   /db_xref="IMGT/HLA:C*03:85"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5L7X0"
FT                   /protein_id="ADE59301.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYNRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   gap             271..516
FT                   /estimated_length=246
FT   gap             793..1378
FT                   /estimated_length=586
XX
SQ   Sequence 1654 BP; 172 A; 246 C; 287 G; 117 T; 832 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aaccgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacatcatc cagaggatgt       540
     atggctgcga cgtggggccc gacgggcgcc tcctccgcgg gtatgaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag ctgagagcct       720
     acctggaggg cctgtgcgtg gagtggctcc gcagatacct gaagaatggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnaa      1380
     cacccaaaga cacacgtgac ccaccatccc gtctctgacc atgaggccac cctgaggtgc      1440
     tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagtggga tggggaggac      1500
     caaactcagg acactgagct tgtggagacc aggccagcag gagatggaac cttccagaag      1560
     tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacgtgcca tgtgcagcac      1620
     gaggggctgc cggagcccct caccctgaga tggg                                  1654
//


spacer
spacer