spacer

EBI Dbfetch

ID   GU575125; SV 1; linear; genomic DNA; STD; HUM; 1260 BP.
XX
AC   GU575125;
XX
DT   22-MAR-2010 (Rel. 104, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA-030
DE   allele, exons 2 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1260
RX   DOI; 10.1111/j.1399-0039.2010.01601.x.
RX   PUBMED; 21299524.
RA   Furst D., Solgi G., Recker K., Mytilineos D., Schrezenmeier H.,
RA   Mytilineos J.;
RT   "Sequence-based typing of major histocompatibility complex class I
RT   chain-related gene A alleles by use of exons 2-5 information";
RL   Tissue Antigens 77(3):201-205(2011).
XX
RN   [2]
RP   1-1260
RA   Fuerst D., Recker K., Mytilineos J.;
RT   "IHWG09460, FH71 cell line, MICA*030 allele, exons 2-5";
RL   Unpublished.
XX
RN   [3]
RP   1-1260
RA   Fuerst D., Recker K., Mytilineos J.;
RT   ;
RL   Submitted (28-JAN-2010) to the INSDC.
RL   Transplantation Immunology, IKT, Helmholtzstr 10, Ulm, BW 89081, Germany
XX
DR   MD5; 8fb4a111a4dd2a0d344a26d849e37f8e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="FH71"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1260
FT                   /gene="MICA"
FT                   /allele="030"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1260)
FT                   /gene="MICA"
FT                   /allele="030"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1260)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="030"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="cell surface molecule; ligand of the NKG2D-receptor"
FT                   /db_xref="GOA:D4P5A5"
FT                   /db_xref="IMGT/HLA:MICA*030"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4P5A5"
FT                   /protein_id="ADD73556.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHAVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAIFVIIIFYVCCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="030"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="030"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="030"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1260
FT                   /gene="MICA"
FT                   /allele="030"
FT                   /number=5
XX
SQ   Sequence 1260 BP; 242 A; 241 C; 271 G; 206 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acaatgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact       840
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacg ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct gctatttttg      1200
     ttattattat tttctatgtc tgttgttgta agaagaaaac atcagctgca gagggtccag      1260
//


spacer
spacer