spacer

EBI Dbfetch

ID   GU570429; SV 1; linear; genomic DNA; STD; HUM; 1210 BP.
XX
AC   GU570429;
XX
DT   24-MAR-2010 (Rel. 104, Created)
DT   24-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*48 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1210
RA   Yan L., An S., Xie J., Liu N., Li S., Dong L., Dong Z., Yuan Y.;
RT   "A novel HLA-B*48 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1210
RA   Yan L., An S., Xie J., Liu N., Li S., Dong L., Dong Z., Yuan Y.;
RT   ;
RL   Submitted (26-JAN-2010) to the INSDC.
RL   Tissue Typing Lab, Tianjin Blood Center, Huanghe Road, Tianjin 300110,
RL   China
XX
DR   MD5; 7725f53f45ba05d66f6b81b08396b583.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1210
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: primer-P1, rev_name:
FT                   primer-P2"
FT                   /db_xref="taxon:9606"
FT   gene            <26..>1017
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT   mRNA            join(<26..98,227..496,742..>1017)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(26..98,227..496,742..>1017)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D4P4X3"
FT                   /db_xref="IMGT/HLA:B*48:22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D4P4X3"
FT                   /protein_id="ADD83055.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
XX
SQ   Sequence 1210 BP; 216 A; 389 C; 427 G; 178 T; 0 other;
     actcagagtc tcctcagacg ccgagatgct ggtcatggcg ccccgaaccg tcctcctgct        60
     gctctcggcg gccctggccc tgaccgagac ctgggccggt gagtgcgggt cgggagggaa       120
     atggcctctg ccgggaggag cgaggggacc gcaggcgggg gcgcaggacc tgaggagccg       180
     cgccgggagg agggtcgggc gggtctcagc ccctcctcac ccccaggctc ccactccatg       240
     aggtatttcc acaccgccat gtcccggccc ggccgcgggg agccccgctt catctcagtg       300
     ggctacgtgg acgacaccca gttcgtgagg ttcgacagcg acgccgcgag tccgagagag       360
     gagccgcggg cgccgtggat agagcaggag gggccggagt attgggaccg ggagacacag       420
     atctccaaga ccaacacaca gacttaccga gagagcctgc ggaacctgcg cggctactac       480
     aaccagagcg aggccggtga gtgaccccgg cccggggcgc aggtcacgac tccccatccc       540
     ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag atccgcctcc ctgaggccgc       600
     gggacccgcc cagaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt       660
     cagttgaggc caaaatcccc gcgggttggt cggggcgggg cggggctcgg gggactgggc       720
     tgaccgcggg gccggggcca gggtctcaca ccctccagag catgtacggc tgcgacgtgg       780
     ggccggacgg gcgcctcctc cgcgggcata accagtacgc ctacgacggc aaggattaca       840
     tcgccctgaa cgaggacctg cgctcctgga ccgccgcgga cacggcggct cagatctccc       900
     agcgcaagtt ggaggcggcc cgtgtggcgg agcagctgag agcctacctg gagggcgagt       960
     gcgtggagtg gctccgcaga tacctggaga acgggaagga caagctggag cgcgctggta      1020
     ccaggggcag tggggagcct tccccatctc ctataggtcg ccggggatgg cctcccacga      1080
     gaagaggagg aaaatgggat cagcgctaga atgtcgccct ccgttgaatg gagaatggca      1140
     tgagttttcc tgagtttcct ctgagggccc cctcttctct ctagacaatt aaggaatgac      1200
     gtctctgagg                                                             1210
//


spacer
spacer