spacer

EBI Dbfetch

ID   GU564533; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU564533;
XX
DT   08-MAR-2010 (Rel. 104, Created)
DT   08-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*03-new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   He J., Bao X., Qiu Q., Yuan X., Li Y.;
RT   "Homo sapiens MHC class I antigen gene, HLA-DQB1*03 novel allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   He J., Bao X., Qiu Q., Yuan X., Li Y.;
RT   ;
RL   Submitted (25-JAN-2010) to the INSDC.
RL   HLA Lab, Institute of Hematology, 188, Shizi Street, Suzhou, Jiangsu
RL   215006, P.R.China
XX
DR   MD5; be48ac0aa57d081d251ff3d9df7a7365.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D3YLL3"
FT                   /db_xref="IMGT/HLA:DQB1*03:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D3YLL3"
FT                   /protein_id="ADD23527.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNHQLELRTTLQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 62 A; 72 C; 92 G; 44 T; 0 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aaccaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer