spacer

EBI Dbfetch

ID   GU551917; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU551917;
XX
DT   06-APR-2011 (Rel. 108, Created)
DT   06-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens clone DRB1_682_00323 MHC class II antigen (HLA-DRB1) gene,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (20-JAN-2010) to the INSDC.
RL   Histogenetics, 300 Executive Blvd, Ossining, NY 10562, USA
XX
DR   MD5; f06e64848608bf5715eac56adbff464d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="DRB1_682_00323"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F2VNV8"
FT                   /db_xref="IMGT/HLA:DRB1*11:103"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2VNV8"
FT                   /protein_id="ADE58766.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 61 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer