spacer

EBI Dbfetch

ID   GU391034; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   GU391034;
XX
DT   25-FEB-2010 (Rel. 103, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*37 new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RX   PUBMED; 23020614.
RA   Li J.P., Li X.F., Zhang X., Zhang K.L., Liu X.Z.;
RT   "Identification of a novel allele, HLA-B*37:04:02, from a registered donor
RT   of the China Marrow Donor Program";
RL   Tissue Antigens 80(6):543-545(2012).
XX
RN   [2]
RP   1-791
RA   Li J.-P.;
RT   "A new HLA-B*37 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-791
RA   Li J.-P.;
RT   ;
RL   Submitted (06-JAN-2010) to the INSDC.
RL   HLA Lab, Liaoning Blood Center, Beihai Street, Shenyang, Liaoning 110044,
RL   China
XX
DR   MD5; cf613b134dc0cb84442d28aed50e37e0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37 new"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3Y2R2"
FT                   /db_xref="IMGT/HLA:B*37:04:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3Y2R2"
FT                   /protein_id="ADC92288.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTLLRYYNQSEAGSHTIQRMSGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   gap             271..515
FT                   /estimated_length=245
XX
SQ   Sequence 791 BP; 111 A; 176 C; 187 G; 72 T; 245 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccatcc agaggatgtc       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg tataaccagt tcgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagg acagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgca g                                                            791
//


spacer
spacer