spacer

EBI Dbfetch

ID   GU370890; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   GU370890;
XX
DT   10-FEB-2010 (Rel. 103, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*08 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/tan.12153.
RX   PUBMED; 23849073.
RA   Zhang X., Li X.F., Lin F.Q., Zhang K.L., Li J.P.;
RT   "Detection of the new HLA-B*08:57 allele in a voluntary platelet donor";
RL   Tissue Antigens 82(2):144-145(2013).
XX
RN   [2]
RP   1-646
RA   Li J.-P.;
RT   ;
RL   Submitted (31-DEC-2009) to the INSDC.
RL   HLA Lab, Liaoning Blood Center, Beihai Street, Shenyang, Liaoning 110044,
RL   China
XX
DR   MD5; dbbea4e66504640472ce3efe1fa98be5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3K4I3"
FT                   /db_xref="IMGT/HLA:B*08:57"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3K4I3"
FT                   /protein_id="ADC42110.1"
FT                   /translation="SHSMRYFDTAISRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 114 A; 174 C; 190 G; 68 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccatctcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//


spacer
spacer