spacer

EBI Dbfetch

ID   GU357633; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   GU357633;
XX
DT   10-FEB-2010 (Rel. 103, Created)
DT   10-FEB-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*30 new allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Yu M., Hall J.E., Caparelli E., Czech J., Silva M., Hartman K.,
RA   Jennings L.;
RT   "A novel HLA-A*30 allele identified by PCR-SBT in an Argentina stem cell
RT   transplantation donor";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Yu M., Hall J.E., Caparelli E., Czech J., Silva M., Hartman K.,
RA   Jennings L.;
RT   ;
RL   Submitted (23-DEC-2009) to the INSDC.
RL   HLA and Molecular Diagnostic Lab, Children's Memorial Hospital, 2300
RL   Children's Plaza, Chicago, IL 60614, USA
XX
DR   MD5; 2bf142e62ea70dddf2c5aa6ccdb92aff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: Ain1-G-M13F, rev_name:
FT                   Ain1-G-M13R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30 new"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30 new"
FT                   /product="MHC class I antigen"
FT                   /note="HLA class I antigen"
FT                   /db_xref="GOA:D3K283"
FT                   /db_xref="IMGT/HLA:A*30:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3K283"
FT                   /protein_id="ADC44434.1"
FT                   /translation="SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAARITQRKWEAARWAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30 new"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30 new"
FT                   /number=3
XX
SQ   Sequence 787 BP; 146 A; 243 C; 282 G; 116 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggcagt ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggccgggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttga cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaattccc ccgggttggt cggggctggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtatg aacagcacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cggatcaccc agcgcaagtg ggaggcggcc cgttgggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer