spacer

EBI Dbfetch

ID   GU329994; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   GU329994;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   15-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1501 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RX   DOI; 10.1111/j.1399-0039.2010.01495.x.
RX   PUBMED; 20545904.
RA   Han S.H., Heo Y.A., Kwon O.J., Yoon H.R., Lee K.R.;
RT   "A new HLA-B*15 allele, HLA-B*9587, identified by sequence-based typing in
RT   a Korean individual";
RL   Tissue Antigens 76(3):253-255(2010).
XX
RN   [2]
RP   1-791
RA   Han S.-H., Heo Y.-A., Lee K.-R.;
RT   ;
RL   Submitted (06-DEC-2009) to the INSDC.
RL   Molecular genetics, Seoul Clinical Laboratories, 7-14, Dongbinggo-dong,
RL   Yongsan-gu, Seoul 140-809, Korea
XX
DR   MD5; 2583ea8104a2f8702047e2d401fb6c93.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1501 variant"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1501 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1501 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D2Y561"
FT                   /db_xref="IMGT/HLA:B*15:187"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D2Y561"
FT                   /protein_id="ADB55554.1"
FT                   /translation="SHSMRYFYTAMSRPGRGQPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1501 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1501 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 110 A; 174 C; 192 G; 70 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc gggcagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer