spacer

EBI Dbfetch

ID   GU324266; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU324266;
XX
DT   05-FEB-2010 (Rel. 103, Created)
DT   05-FEB-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*06var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Recker K., Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-DQB1*06";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Recker K., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (15-DEC-2009) to the INSDC.
RL   Transplant Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081, Germany
XX
DR   MD5; c1df2b0e575637b4867696e54e14a174.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06var"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06var"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06var"
FT                   /product="MHC class II antigen"
FT                   /note="human leucocyte antigen"
FT                   /db_xref="GOA:D3JWS0"
FT                   /db_xref="IMGT/HLA:DQB1*06:40"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D3JWS0"
FT                   /protein_id="ADC29455.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHVYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRR"
XX
SQ   Sequence 270 BP; 59 A; 66 C; 100 G; 45 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacgtc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//


spacer
spacer