spacer

EBI Dbfetch

ID   GU322370; SV 1; linear; genomic DNA; STD; HUM; 1632 BP.
XX
AC   GU322370;
XX
DT   28-JAN-2010 (Rel. 103, Created)
DT   28-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2402 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1632
RA   Teniente A., Caro P., Gil J., Campos E., Mantecon S., Ambros C., Mongay L.,
RA   Pujol-Borrell R., Herrero M.J., Palou E.;
RT   "Identification of a new HLA-A*2402 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1632
RA   Teniente A., Caro P., Gil J., Campos E., Mantecon S., Ambros C., Mongay L.,
RA   Pujol-Borrell R., Herrero M.J., Palou E.;
RT   ;
RL   Submitted (15-DEC-2009) to the INSDC.
RL   LIRAD, Banc de Sang i Teixits, Crtra de Can Ruti, s/n, Badalona 08916,
RL   Spain
XX
DR   MD5; c1d94553fb673155ddf3306425b58eac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1632
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1632
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2402"
FT   mRNA            join(<1..270,512..787,1357..>1632)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2402"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1357..>1632)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2402"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3JW65"
FT                   /db_xref="IMGT/HLA:A*24:02:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3JW65"
FT                   /protein_id="ADB85766.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2402"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2402"
FT                   /number=3
FT   gap             788..1356
FT                   /estimated_length=569
FT   exon            1357..1632
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2402"
FT                   /number=4
XX
SQ   Sequence 1632 BP; 173 A; 249 C; 279 G; 121 T; 810 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca catatgaccc      1380
     accaccccat ctctgaccat gaggccactc tgagatgctg ggccctgggc ttctaccctg      1440
     cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac acggagcttg      1500
     tggagactag gcctgcaggg gatggaacct tccagaagtg ggcagctgtg gtggtacctt      1560
     ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca      1620
     ccctgagatg gg                                                          1632
//


spacer
spacer