spacer

EBI Dbfetch

ID   GU322369; SV 1; linear; genomic DNA; STD; HUM; 1632 BP.
XX
AC   GU322369;
XX
DT   28-JAN-2010 (Rel. 103, Created)
DT   28-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*80 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1632
RA   Teniente A., Caro P., Gil J., Campos E., Mantecon S., Ambros C., Mongay L.,
RA   Pujol-Borrell R., Herrero M.J., Palou E.;
RT   "Identification of a new HLA-A*80 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1632
RA   Teniente A., Caro P., Gil J., Campos E., Mantecon S., Ambros C., Mongay L.,
RA   Pujol-Borrell R., Herrero M.J., Palou E.;
RT   ;
RL   Submitted (11-DEC-2009) to the INSDC.
RL   LIRAD, Banc de Sang i Teixits, Crtra de Can Ruti, s/n, Badalona 08916,
RL   Spain
XX
DR   MD5; d25330ad894813cd3ddc6921de60f1bb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1632
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1632
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80"
FT   mRNA            join(<1..270,512..787,1357..>1632)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1357..>1632)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3JW64"
FT                   /db_xref="IMGT/HLA:A*80:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3JW64"
FT                   /protein_id="ADB85765.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDSQFVQFDSDAASQRME
FT                   PRAPWIEQEEPEYWDEETRNVKAHSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAARRAEQLRAYLEGEC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGKEKRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80"
FT                   /number=3
FT   gap             788..1356
FT                   /estimated_length=569
FT   exon            1357..1632
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80"
FT                   /number=4
XX
SQ   Sequence 1632 BP; 172 A; 246 C; 284 G; 120 T; 810 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgact cgcagttcgt gcagttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggagccg gagtattggg       180
     acgaggagac acggaatgtg aaggcccact cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc cgtcgggcgg agcagctgag agcctacctg       720
     gagggcgagt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca catatgaccc      1380
     accaccccat ctctgaccat gaggccactc tgaggtgctg ggccctgagc ttctaccctg      1440
     cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg      1500
     tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtacctt      1560
     ctggaaagga gaagagatac acctgccatg tgcagcatga gggtctgccc gagcccctca      1620
     ccctgagatg gg                                                          1632
//


spacer
spacer