spacer

EBI Dbfetch

ID   GU320633; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   GU320633;
XX
DT   27-JAN-2010 (Rel. 103, Created)
DT   27-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens clone BY00619 MHC class I antigen (HLA-C) gene, HLA-Cw*070101
DE   variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (14-DEC-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; c87c9bd316d48a0e2ca9de7055936d5f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="BY00619"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*070101 variant"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*070101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*070101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3JV25"
FT                   /db_xref="IMGT/HLA:C*07:141:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3JV25"
FT                   /protein_id="ADB80081.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*070101 variant"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*070101 variant"
FT                   /number=3
XX
SQ   Sequence 792 BP; 105 A; 173 C; 199 G; 69 T; 246 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgc ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc ag                                                           792
//


spacer
spacer