spacer

EBI Dbfetch

ID   GU320632; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   GU320632;
XX
DT   27-JAN-2010 (Rel. 103, Created)
DT   27-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens clone BY00618 MHC class I antigen (HLA-C) gene, HLA-Cw*020202
DE   variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (14-DEC-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; d72ac809b5880d9e382b6c27cb8896ab.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="BY00618"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*020202 variant"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*020202 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*020202 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3JV24"
FT                   /db_xref="IMGT/HLA:C*02:26:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3JV24"
FT                   /protein_id="ADB80080.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*020202 variant"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*020202 variant"
FT                   /number=3
XX
SQ   Sequence 792 BP; 110 A; 169 C; 198 G; 69 T; 246 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     acggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacag       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag tggagagcct       720
     acctggaggg cgagtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer