spacer

EBI Dbfetch

ID   GU248313; SV 2; linear; genomic DNA; STD; HUM; 1516 BP.
XX
AC   GU248313;
XX
DT   27-DEC-2009 (Rel. 103, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35new allele, exons 2
DE   through 7 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1516
RX   DOI; 10.1111/j.1399-0039.2010.01631.x.
RX   PUBMED; 21388359.
RA   Tang Zh.H., Li G.Y., Wang M.L., Liu Y.Y., Li Y.R., Fang L.H.;
RT   "Identification of a novel HLA-B*35:42:02 allele in a Chinese bone marrow
RT   donor";
RL   Tissue Antigens 77(4):341-342(2011).
XX
RN   [2]
RP   1-1516
RA   Tang Z., Li G., Wang M., Liu Y.;
RT   ;
RL   Submitted (30-NOV-2009) to the INSDC.
RL   HLA Laboratory, Transfusion Research Institute, Blood Center of Gansu
RL   Province, Yanchang Road, Xiaogou Lane No. 1, Lanzhou, Gansu 730010, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1516
RA   Tang Z., Li G., Wang M., Liu Y.;
RT   ;
RL   Submitted (29-DEC-2009) to the INSDC.
RL   HLA Laboratory, Transfusion Research Institute, Blood Center of Gansu
RL   Province, Yanchang Road, Xiaogou Lane No. 1, Lanzhou, Gansu 730010, China
XX
DR   MD5; 92c362b38aae982619df6b5735d3557b.
XX
CC   On Dec 29, 2009 this sequence version replaced gi:281485065.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1516
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT   mRNA            join(<1..270,371..646,747..1022,1123..1239,1340..1372,
FT                   1473..>1516)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..1022,1123..1239,1340..1372,
FT                   1473..1516)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D2KPG8"
FT                   /db_xref="IMGT/HLA:B*35:42:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D2KPG8"
FT                   /protein_id="ADA70350.2"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTI
FT                   PIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1239
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=5
FT   gap             1240..1339
FT                   /estimated_length=unknown
FT   exon            1340..1372
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=6
FT   gap             1373..1472
FT                   /estimated_length=unknown
FT   exon            1473..>1516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=7
XX
SQ   Sequence 1516 BP; 214 A; 308 C; 331 G; 163 T; 500 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca cacgtgaccc accaccccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag       900
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1020
     ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnagccatct tcccagtcca      1140
     ccatccccat cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag      1200
     ctgtggtcgc tactgtgatg tgtaggagga agagctcagn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnng tggaaaagga gggagctact ctcaggctgc gtnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnccagcgac agtgcccagg gctctgatgt      1500
     gtctctcaca gcttga                                                      1516
//


spacer
spacer