spacer

EBI Dbfetch

ID   GU186855; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU186855;
XX
DT   16-DEC-2009 (Rel. 103, Created)
DT   16-DEC-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens isolate 09-108 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*140301 new allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kim K.W., Lee S.M., Park Y.M., Kwon O.J., Kwon S.Y., Oh D.J.;
RT   "New HLA-DRB1*140301 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Kim K.W., Lee S.M., Park Y.M., Kwon O.J., Kwon S.Y., Oh D.J.;
RT   ;
RL   Submitted (09-NOV-2009) to the INSDC.
RL   Immuno-Hematology Division, Blood Transfusion Research Institute, 764
RL   Sanggye 6 Dong, No-won gu, Seoul 139-851, South Korea
XX
DR   MD5; 38c922f1743dd4b05a752d2b668c95b4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="09-108"
FT                   /mol_type="genomic DNA"
FT                   /country="South Korea"
FT                   /isolation_source="marrow"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140301 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140301 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140301 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D2K7S2"
FT                   /db_xref="IMGT/HLA:DRB1*14:98"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D2K7S2"
FT                   /protein_id="ACZ69520.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRALVDNYCRHNYGVGESFTVQRR"
FT   variation       217..218
FT                   /gene="HLA-DRB1"
FT                   /replace="cc"
FT                   /note="results in an asparagine to threonine substitution"
XX
SQ   Sequence 270 BP; 59 A; 63 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccctgg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer