Dbfetch

ID   GU186854; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU186854;
XX
DT   16-DEC-2009 (Rel. 103, Created)
DT   16-DEC-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens isolate 09-2790 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*140501 new allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kim K.W., Park Y.M., Kwon O.J., Kwon S.Y., Oh D.J.;
RT   "HLA-DRBI*140501 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Kim K.W., Park Y.M., Kwon O.J., Kwon S.Y., Oh D.J.;
RT   ;
RL   Submitted (09-NOV-2009) to the INSDC.
RL   Immuno-Hematology Division, Blood Transfusion Research Institute, 764
RL   Sanggye 6 Dong, No-won gu, Seoul 139-851, South Korea
XX
DR   MD5; 7bf861b2a8d608f33b88d6492631a80b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="09-2790"
FT                   /mol_type="genomic DNA"
FT                   /country="South Korea"
FT                   /isolation_source="marrow"
FT                   /note="PCR_primers=fwd_name: intron 1, rev_name: intron 2"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140501 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140501 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140501 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D2K7S1"
FT                   /db_xref="IMGT/HLA:DRB1*14:96"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D2K7S1"
FT                   /protein_id="ACZ69519.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   variation       139
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /note="results in an arginine to threonine substitution"
XX
SQ   Sequence 270 BP; 56 A; 62 C; 100 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//