spacer

EBI Dbfetch

ID   GU145554; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   GU145554;
XX
DT   31-OCT-2010 (Rel. 106, Created)
DT   31-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens isolate sdbc-o7d MHC class I antigen (HLA-B) gene,
DE   HLA-B*350301 variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Zhu C., Liu Y., Zhang Y., Song Y., Hurley C.K., Lazaro A., Xiao Y.;
RT   "Identification of novel HLA-B*350301 variant by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Zhu C., Liu Y., Zhang Y., Song Y., Hurley C.K., Lazaro A., Xiao Y.;
RT   ;
RL   Submitted (30-OCT-2009) to the INSDC.
RL   HLA Lab, Blood Center of Shandong Province, 22 East Shanshi Road, Jinan,
RL   Shandong 250014, China
XX
DR   MD5; 5c977006f34cff403cfbc8f8fb39f632.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /isolate="sdbc-o7d"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350301 variant"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350301 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350301 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E3T1V2"
FT                   /db_xref="IMGT/HLA:B*35:03:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E3T1V2"
FT                   /protein_id="ADO22684.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350301 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350301 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 112 A; 172 C; 188 G; 74 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacatcatcc agaggatgta       540
     tggctgcgac ctggggccgg acgggcgcct cctccgcggg catgaccagt tcgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer