spacer

EBI Dbfetch

ID   GU136390; SV 1; linear; genomic DNA; STD; HUM; 811 BP.
XX
AC   GU136390;
XX
DT   24-NOV-2009 (Rel. 102, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Homo sapiens isolate CMN-N10 MHC class I antigen (HLA-B) gene, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-811
RX   DOI; 10.1111/j.1399-0039.2010.01544.x.
RX   PUBMED; 20727118.
RA   Chu C.C., Lee K.C., Lee H.L., Lai S.K., Lin M.;
RT   "Identification of the novel allele HLA-B*13:01:03 by sequence-based typing
RT   method in a Taiwanese individual";
RL   Tissue Antigens 76(6):496-497(2010).
XX
RN   [2]
RP   1-811
RA   Chu C.-C.;
RT   ;
RL   Submitted (27-OCT-2009) to the INSDC.
RL   Department of Medical Research, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 2e2faf4ff4501373fde3fc5607bb545e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811
FT                   /organism="Homo sapiens"
FT                   /isolate="CMN-N10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>811
FT                   /gene="HLA-B"
FT   mRNA            join(<11..280,526..>801)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,526..>801)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D1MEK4"
FT                   /db_xref="IMGT/HLA:B*13:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D1MEK4"
FT                   /protein_id="ACZ26469.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            11..280
FT                   /gene="HLA-B"
FT                   /product="HLA-B"
FT                   /number=2
FT   exon            526..801
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 811 BP; 147 A; 273 C; 285 G; 106 T; 0 other;
     tggcccccag gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc        60
     ggggagcccc gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac       120
     agcgacgcca cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg       180
     gagtattggg accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac       240
     ctgcgcaccg cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgactcccca tcccccacgg acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       420
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       480
     ggggcggggc tcgggggacg gggctgaccg cggggccggg gccagggtct cacatcatcc       540
     agaggatgta tggctgcgac ctggggccgg acgggcgcct cctccgcggg cacaaccagt       600
     tagcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg       660
     cggacaccgc ggctcagatc acccagctca agtgggaggc ggcccgtgtg gcggagcagc       720
     tgagagccta cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga       780
     aggagacgct gcagcgcgcg ggtaccaggg g                                      811
//


spacer
spacer