spacer

EBI Dbfetch

ID   GU066743; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   GU066743;
XX
DT   02-NOV-2009 (Rel. 102, Created)
DT   02-NOV-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*140201 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (07-OCT-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 7a3c8fbedfe3baf14cfd9f50f2dafe9d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140201 variant"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140201 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140201 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D0VE38"
FT                   /db_xref="IMGT/HLA:B*14:02:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D0VE38"
FT                   /protein_id="ACY09092.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQWMYGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140201 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140201 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 113 A; 169 C; 192 G; 72 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactga ccgagagagc ctgcggaact       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agtggatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg tataaccagt tcgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer