spacer

EBI Dbfetch

ID   GU060679; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GU060679;
XX
DT   14-OCT-2009 (Rel. 102, Created)
DT   14-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1132variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Curcio M., Fornaciari S., Barbuti S., Andreoli E., Pistello M., Scatena F.,
RA   Mariotti M.L.;
RT   "A novel HLA-DRB1 allele, DRB1*11xx, identified by sequence-based typing in
RT   an Italian family";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Curcio M., Fornaciari S., Barbuti S., Andreoli E., Pistello M., Scatena F.,
RA   Mariotti M.L.;
RT   ;
RL   Submitted (05-OCT-2009) to the INSDC.
RL   U.O. Immunohematology, Azienda Ospedaliera Universitaria Pisana, via
RL   Paradisa, 2, Pisa, PI 56100, Italy
XX
DR   MD5; 4f2c64ded33a393737da1da0966519f8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1132variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1132variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1132variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D0FI72"
FT                   /db_xref="IMGT/HLA:DRB1*11:89"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D0FI72"
FT                   /protein_id="ACX50898.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1132variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 61 C; 99 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer