spacer

EBI Dbfetch

ID   GU016622; SV 1; linear; genomic DNA; STD; HUM; 2917 BP.
XX
AC   GU016622;
XX
DT   21-OCT-2009 (Rel. 102, Created)
DT   27-APR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02 new allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2917
RX   DOI; 10.1111/j.1399-0039.2011.01756.x.
RX   PUBMED; 21859428.
RA   Nie D.M., Zou H.Y.;
RT   "Full-length sequence of a novel HLA-A*02:230 allele";
RL   Tissue Antigens 79(1):68-69(2012).
XX
RN   [2]
RP   1-2917
RA   Zou H.-Y.;
RT   ;
RL   Submitted (25-SEP-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 02f08de9a875fa6c7c1d02cf8196081f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2917
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2917
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 new"
FT   mRNA            join(<1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2913..>2917)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2913..2917)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D0V481"
FT                   /db_xref="IMGT/HLA:A*02:230"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D0V481"
FT                   /protein_id="ACX71838.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMT
FT                   AQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   variation       858
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020301"
FT                   /replace="g"
XX
SQ   Sequence 2917 BP; 571 A; 829 C; 906 G; 611 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaac       120
     gggcccgcct ggcgggggcg caggacccgg gaagccgcgc cgggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctctca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggt ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac       420
     tcaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccaggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgaccgc ggggtccggg ccaggttctc       720
     acaccgtcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatgaca gctcagacca ccaagcacaa gtgggagacg gcccatgagg       900
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtcct tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1620
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggac      1800
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1860
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1920
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      1980
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2040
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2100
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2160
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2220
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2280
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2340
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2400
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2460
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2520
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2580
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2640
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      2700
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      2760
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      2820
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      2880
     acgaatttgt tcatgaatat ttttttctat agtgtga                               2917
//


spacer
spacer