Dbfetch

ID   GU014287; SV 1; linear; genomic DNA; STD; HUM; 628 BP.
XX
AC   GU014287;
XX
DT   28-OCT-2009 (Rel. 102, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQA1) gene, HLA-DQA1*05 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-628
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a new HLA-DQA1*05 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-628
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (28-SEP-2009) to the INSDC.
RL   Histocompatibility, CTM, Avenida de la Democracia, Madrid 28032, Spain
XX
DR   MD5; db44eb5b1b4238c2320a3838c6e7b221.
DR   EuropePMC; PMC4049365; 24936514.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..628
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>628
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05"
FT   mRNA            join(<1..246,347..>628)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..246,347..>628)
FT                   /codon_start=3
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05"
FT                   /product="MHC class II antigen"
FT                   /note="human leukocyte DQ antigen"
FT                   /db_xref="GOA:D0V3Q3"
FT                   /db_xref="IMGT/HLA:DQA1*05:10"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D0V3Q3"
FT                   /protein_id="ACY06698.1"
FT                   /translation="DHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPV
FT                   LRQFRFDPQFALTNIAVLKHNLNSLVKRSNSTAATNEVPEVTVFSKSPVTLGQPNILIC
FT                   LVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVE
FT                   HWGLDKPLLKHW"
FT   gap             247..346
FT                   /estimated_length=unknown
XX
SQ   Sequence 628 BP; 123 A; 143 C; 120 G; 142 T; 100 other;
     ctgaccacgt cgcctcttat ggtgtaaact tgtaccagtc ttacggtccc tctggccagt        60
     acacccatga atttgatgga gatgagcagt tctacgtgga cctggggagg aaggagactg       120
     tctggtgttt gcctgttctc agacaattta gatttgaccc gcaatttgca ctgacaaaca       180
     tcgctgtcct aaaacataac ttgaacagtc tggttaaacg ctccaactct accgctgcta       240
     ccaatgnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaggt tcctgaggtc       360
     acagtgtttt ccaagtctcc cgtgacactg ggtcagccca acatcctcat ctgtcttgtg       420
     gacaacatct ttcctcctgt ggtcaacatc acatggctga gcaatgggca ctcagtcaca       480
     gaaggtgttt ctgagaccag cttcctctcc aagagtgatc attccttctt caagatcagt       540
     tacctcaccc tcctcccttc tgctgaggag agttatgact gcaaggtgga gcactgggga       600
     ctggacaagc ctcttctgaa acactggg                                          628
//