spacer

EBI Dbfetch

ID   GQ999128; SV 1; linear; genomic DNA; STD; HUM; 914 BP.
XX
AC   GQ999128;
XX
DT   02-NOV-2009 (Rel. 102, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*12 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-914
RX   DOI; 10.1111/j.1399-0039.2010.01537.x.
RX   PUBMED; 20663103.
RA   Sun H., Miao F., Pan N., Shen Y., Xie W., Zhang J.;
RT   "Identification of a novel HLA-C allele, C*12:10:02, in a Chinese
RT   individual";
RL   Tissue Antigens 76(5):424-425(2010).
XX
RN   [2]
RP   1-914
RA   Zhang J., Xie W., Sun H., Miao F., Pan N.;
RT   "Two novel HLA class I alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-914
RA   Zhang J., Xie W., Sun H., Miao F., Pan N.;
RT   ;
RL   Submitted (24-SEP-2009) to the INSDC.
RL   Department of Genetics and Developmental, Southeast University Medical
RL   School, No.87 DingJiaQiao Road, Nanjing, Jiangsu 210009, China
XX
DR   MD5; a8efe64b362aafbc5242631cee95ef93.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..914
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>914
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12 variant"
FT   mRNA            join(<89..358,605..>880)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<89..358,605..>880)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D0V0K7"
FT                   /db_xref="IMGT/HLA:C*12:10:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D0V0K7"
FT                   /protein_id="ACY24446.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMFGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            89..358
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12 variant"
FT                   /number=2
FT   exon            605..880
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12 variant"
FT                   /number=3
XX
SQ   Sequence 914 BP; 154 A; 306 C; 337 G; 117 T; 0 other;
     gcgaggtgcc cgcccggcga gggcgcagga cccggggagc cgcgcaggga ggagggtcgg        60
     gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaggtattt ctacaccgcc       120
     gtgtcccggc ccggccgcgg agagccccgc ttcatcgcag tgggctacgt ggacgacacg       180
     cagttcgtgc ggttcgacag cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg       240
     gtggagcagg aggggccgga gtattgggac cgggagacac agaagtacaa gcgccaggca       300
     caggctgacc gagtgagcct gcggaacctg cgcggctact acaaccagag cgaggccggt       360
     gagtgacccc ggcccggggc gcaggtcacg acccctcccc atcccccacg gacggcccgg       420
     gtcgccccga gtctcccggt ctgagatcca ccccgaggct gcggaacccg cccagaccct       480
     cgaccggaga gagccccagt cacctttacc cggtttcatt ttcagtttag gccaaaatcc       540
     ccgcgggttg gtcggggctg gggcggggct cgggggacgg ggctgaccac gggggcgggg       600
     ccagggtctc acaccctcca gaggatgttt ggctgcgacc tggggcccga cgggcgcctc       660
     ctccgcgggt atgaccagtc cgcctacgac ggcaaggatt acatcgccct gaacgaggac       720
     ctgcgctcct ggaccgctgc ggacacggcg gctcagatca cccagcgcaa gtgggaggcg       780
     gcccgtgagg cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc       840
     agatacctgg agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg cagtggggag       900
     ccttccccat ctcc                                                         914
//


spacer
spacer