spacer

EBI Dbfetch

ID   GQ996942; SV 1; linear; genomic DNA; STD; HUM; 4290 BP.
XX
AC   GQ996942;
XX
DT   21-OCT-2009 (Rel. 102, Created)
DT   21-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0207 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4290
RA   Xu Y., Deng Z., Wang D.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4290
RA   Xu Y., Deng Z., Wang D.;
RT   ;
RL   Submitted (23-SEP-2009) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2# Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 1c8635a5abfbc5971c096eeb123b59bd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4290
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            1..4290
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0207"
FT   misc_feature    1..822
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0207"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<823..895,1026..1295,1537..1812,2413..2688,2788..2904,
FT                   3343..3375,3518..3565,3735..4290)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0207"
FT                   /product="MHC class I antigen"
FT   CDS             join(823..895,1026..1295,1537..1812,2413..2688,2788..2904,
FT                   3343..3375,3518..3565,3735..3739)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0207"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; human leucocyte antigen class I
FT                   molecule"
FT                   /db_xref="GOA:C5IWX5"
FT                   /db_xref="IMGT/HLA:A*02:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IWX5"
FT                   /protein_id="ACX71602.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMCGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   3'UTR           3740..4290
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0207"
XX
SQ   Sequence 4290 BP; 900 A; 1170 C; 1250 G; 970 T; 0 other;
     gtaaatttaa aatactacaa gcaggagtca cagatacatt gtctgggaaa atgcaactta        60
     gtagctttgt gagtcctgtt gtaaggcttt tggacacatt tatacatcaa ggggccaaag       120
     tcacattttt tacctattag attcctgatc attcaggggt taccaagatt ctgctaccca       180
     ctgtagttaa taaacaaaga gcaaattggt ctctattctg tctcatgcac tcaggcgcaa       240
     ctcttcccga ttaaaaacaa aaacaacaac aacaaaaatc tacacctcca ttcccagagc       300
     aagcttactc tctggcacca aactccatgg gatgattttt cttctagaag agtccaggtg       360
     gacaggtaag gagtgggagt cagggagtcc agttcaggga cagagattac gggataaaaa       420
     gtgaaaggag agggacgggg cccatgccga gggtttctcc cttgtttctc agacagctct       480
     tgggccaaga ctcagggaga cattgagaca gagcgcttgg cacagaagca gaggggtcag       540
     ggcgaagtcc cagggcccca ggcgtggctc tcagggtctc aggccccgaa ggcggtgtat       600
     ggattgggga gtcccagcct tggggattcc ccaactccgc agtttctttt ctccctctcc       660
     caacctatgt agggtccttc ttcctggata ctcacgacgc ggacccagtt ctcactccca       720
     ttgggtgtcg ggtttccaga gaagccaatc agtgtcgtcg cggtcgcggt tctaaagtcc       780
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccgt catggcgccc       840
     cgaaccctcg tcctgctact ctcgggggct ctggccctga cccagacctg ggcgggtgag       900
     tgcggggtcg ggagggaaac ggcctctgtg gggagaagca acgggcccgc ctggcggggg       960
     cgcaggaccc gggaagccgc gccgggagga gggtcgggcg ggtctcagcc actcctcgtc      1020
     cccaggctct cactccatga ggtatttctt cacatccgtg tcccggcccg gccgcgggga      1080
     gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga      1140
     cgccgcgagc cagaggatgg agccgcgggc gccgtggata gagcaggagg gtccggagta      1200
     ttgggacggg gagacacgga aagtgaaggc ccactcacag actcaccgag tggacctggg      1260
     gaccctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca      1320
     ggtcacgacc tctcatcccc cacggacggg ccaggtcgcc cacagtctcc gggtccgaga      1380
     tccgccccga agccgcggga ccccgagacc cttgccccgg gagaggccca ggcgccttta      1440
     cccggtttca ttttcagttt aggccaaaaa tccccccagg ttggtcgggg cggggcgggg      1500
     ctcgggggac cgggctgacc gcggggtccg ggccaggttc tcacaccgtc cagaggatgt      1560
     gtggctgcga cgtggggtcg gactggcgct tcctccgcgg gtaccaccag tacgcctacg      1620
     acggcaagga ttacatcgcc ctgaaagagg acctgcgctc ttggaccgcg gcggacatgg      1680
     cagctcagac caccaagcac aagtgggagg cggcccatgt ggcggagcag ttgagagcct      1740
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc      1800
     tgcagcgcac gggtaccagg ggccacgggg cgcctccctg atcgcctgta gatctcccgg      1860
     gctggcctcc cacaaggagg ggagacaatt gggaccaaca ctagaatatc gccctccctc      1920
     tggtcctgag ggagaggaat cctcctgggt ttccagatcc tgtaccagag agtgactctg      1980
     aggttccgcc ctgctctctg acacaattaa gggataaaat ctctgaagga atgacgggaa      2040
     gacgatccct cgaatactga tgagtggttc cctttgacac acacaggcag cagccttggg      2100
     cccgtgactt ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt gtgggggtct      2160
     gagtccagca cttctgagtc cttcagcctc cactcaggtc aggaccagaa gtcgctgttc      2220
     cctcttcagg gactagaatt ttccacggaa taggagatta tcccaggtgc ctgtgtccag      2280
     gctggtgtct gggttctgtg ctcccttccc catcccaggt gtcctgtcca ttctcaagat      2340
     agccacatgt gtgctggagg agtgtcccat gacagatgca aaatgcctga atgatctgac      2400
     tcttcctgac agacgccccc aaaacgcata tgactcacca cgctgtctct gaccatgaag      2460
     ccaccctgag gtgctgggcc ctgagcttct accctgcgga gatcacactg acctggcagc      2520
     gggatgggga ggaccagacc caggacacgg agctcgtgga gaccaggcct gcaggggatg      2580
     gaaccttcca gaagtgggcg gctgtggtgg tgccttctgg acaggagcag agatacacct      2640
     gccatgtgca gcatgagggt ttgcccaagc ccctcaccct gagatggggt aaggagggag      2700
     acgggggtgt catgtctttt agggaaagca ggagcctctc tgacctttag cagggtcagg      2760
     gcccctcacc ttcccctctt ttcccagagc cgtcttccca gcccaccatc cccatcgtgg      2820
     gcatcattgc tggcctggtt ctctttggag ctgtgatcac tggagctgtg gtcgctgctg      2880
     tgatgtggag gaggaagagc tcaggtgggg aaggggtgaa gggtgggtct gagatttctt      2940
     gtctcactga gggttccaag acccaggtag aagtgtgccc tgcctcgtta ctgggaagca      3000
     ccacccacaa ttatgggcct acccagcctg ggccctgtgt gccagcactt actcttttgt      3060
     aaagcacctg ttaaaatgaa ggacagattt atcaccttga ttacagcggt gatgggacct      3120
     gatcccagca gtcacaagtc acaggggaag gtccctgagg accttcagga gggcggttgg      3180
     tccaggaccc acacctgctt tcttcatgtt tcctgatccc gccctgggtc tgcagtcaca      3240
     catttctgga aacttctctg aggtccaaga cttggaggtt cctctaggac cttaaggccc      3300
     tgactccttt ctggtatctc acaggacatt ttcttcccac agatagaaaa ggagggagct      3360
     actctcaggc tgcaagtaag tatgaaggag gctgatgcct gaggtccttg ggatattgtg      3420
     tttgggagcc catgggggag ctcacccacc ccacaattcc tcctctagcc acatcttctg      3480
     tgggatctga ccaggttctg tttttgttct accccaggca gtgacagtgc ccagggctct      3540
     gatgtgtctc tcacagcttg taaaggtgag agcctggagg gcctgatgtg tgttgggtgt      3600
     tgggcggaac agtggacaca gctgtgctat ggggtttctt tccattggat gtattgagca      3660
     tgcgatgggc tgtttaaagt gtgacccctc actgtgacag atacgaattt gttcatgaat      3720
     atttttttct atagtgtgag acagctgcct tgtgtgggac tgagaggcaa gagttgttcc      3780
     tgcccttccc tttgtgactt gaagaaccct gactttgttt ctgcaaaggc acctgcatgt      3840
     gtctgtgttc gtgtaggcat aatgtgagga ggtggggaga ccaccccacc cccatgtcca      3900
     ccatgaccct cttcccacgc tgacctgtgc tccctcccca atcatctttc ctgttccaga      3960
     gaggtggggc tgaggtgtct ccatctctgt ctcaacttca tggtgcactg agctgtaact      4020
     tcttccttcc ctattaaaat tagaacctga gtataaattt actttctcaa attcttgcca      4080
     tgagaggttg atgagttaat taaaggagaa gattcctaaa atttgagaga caaaataaat      4140
     ggaacacatg agaaccttcc agagtccacg tgttgcttat gctgatttgt tgcaggggag      4200
     gagagtagat ggggctgtgc ccagtttctg ttccggccac tatgggcttt atgtggtcac      4260
     tgcttggctg ggtcatcttt gctgctccat                                       4290
//


spacer
spacer