Dbfetch

ID   GQ985505; SV 1; linear; genomic DNA; STD; HUM; 2623 BP.
XX
AC   GQ985505;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   19-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw-Cw*04010101 variant
DE   allele, exons 2 through 7 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2623
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   "Novel HLA class allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2623
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   ;
RL   Submitted (22-SEP-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; d00e0dcfe858722bf0d1347a044c9d2d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2623
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2623
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT   mRNA            join(<1..270,517..792,1480..1755,1877..1996,2436..2468,
FT                   2576..>2623)
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1480..1755,1877..1996,2436..2468,
FT                   2576..>2623)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D0F1S2"
FT                   /db_xref="IMGT/HLA:C*04:01:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D0F1S2"
FT                   /protein_id="ACX56224.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPSSQPTI
FT                   PIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACK
FT                   "
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /number=3
FT   gap             793..1479
FT                   /estimated_length=687
FT   exon            1480..1755
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /number=4
FT   gap             1756..1876
FT                   /estimated_length=121
FT   exon            1877..1996
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /number=5
FT   gap             1997..2435
FT                   /estimated_length=439
FT   exon            2436..2468
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /number=6
FT   gap             2469..2575
FT                   /estimated_length=107
FT   exon            2576..2623
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*04010101 variant"
FT                   /number=7
XX
SQ   Sequence 2623 BP; 208 A; 299 C; 351 G; 165 T; 1600 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcctggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     ttggctgcga cctggggccg gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga      1500
     cccaccatcc cgtctctgac catgaggcca ccctgaggtg ctgggccctg ggcttctacc      1560
     ctgcggagat cacactgacc tggcagtggg atggggagga ccaaactcag gacaccgagc      1620
     ttgtggagac caggccagca ggagatggaa ccttccagaa gtgggcagct gtggtggtgc      1680
     cttctggaga agagcagaga tacacgtgcc atgttcagca cgaggggctg ccggagcccc      1740
     tcaccctgag atggannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnagcc gtcttcccag cccaccatcc ccatcgtggg catcgttgct      1920
     ggcctggctg tcctggctgt cctagctgtc ctaggagcta tggtggctgt tgtgatgtgt      1980
     aggaggaaga gctcagnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngtgga aaaggaggga gctgctctca      2460
     ggctgcgtnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnccagc      2580
     aacagtgccc agggctctga tgagtctctc atcgcttgta aag                        2623
//