Dbfetch

ID   GQ867212; SV 2; linear; genomic DNA; STD; HUM; 784 BP.
XX
AC   GQ867212;
XX
DT   14-OCT-2009 (Rel. 102, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens isolate BY00518 MHC class I antigen (HLA-A) gene, HLA-A*1101
DE   new allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-784
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-784
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (03-SEP-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-784
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (20-JAN-2010) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; cc7d0f64c1d41bea7e411f6b31e5356e.
XX
CC   On Jan 20, 2010 this sequence version replaced gi:260779686.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..784
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00518"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>784
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101 new"
FT   mRNA            join(<1..265,508..>784)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..265,508..>784)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*11:52Q"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:D0EP74"
FT                   /protein_id="ACX50454.2"
FT                   /translation="SHSMRYFYTVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEP
FT                   RAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGPD
FT                   GRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRCV
FT                   EWLRRYLENGKETLQRT"
FT   exon            1..265
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101 new"
FT                   /number=2
FT   gap             266..506
FT                   /estimated_length=241
FT   exon            508..784
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101 new"
FT                   /number=3
XX
SQ   Sequence 784 BP; 110 A; 162 C; 198 G; 73 T; 241 other;
     ctcccactcc atgaggtatt tctacaccgt gtcccggccc ggccgcgggg agccccgctt        60
     catcgccgtg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag       120
     ccagaggatg gagccgcggg cgccgtggat agagcaggag gggccggagt attgggacca       180
     ggagacacgg aatgtgaagg cccagtcaca gactgaccga gtggacctgg ggaccctgcg       240
     cggctactac aaccagagcg aggacnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnngggt tctcacacca tccagataat gtatggctgc       540
     gacgtggggc cggacgggcg cttcctccgc gggtaccggc aggacgccta cgacggcaag       600
     gattacatcg ccctgaacga ggacctgcgc tcttggaccg cggcggacat ggcagctcag       660
     atcaccaagc gcaagtggga ggcggcccat gcggcggagc agcagagagc ctacctggag       720
     ggccggtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc       780
     acgg                                                                    784
//