Dbfetch

ID   GQ856687; SV 1; linear; genomic DNA; STD; HUM; 2903 BP.
XX
AC   GQ856687;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   24-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2404variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2903
RA   Alves H., Peixoto M., Tafulo S., Goncalves R., Vicario J.L., Balas A.;
RT   "Portuguese new HLA-A*24 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2903
RA   Alves H., Peixoto M., Tafulo S., Goncalves R., Vicario J.L., Balas A.;
RT   ;
RL   Submitted (14-AUG-2009) to the INSDC.
RL   Direction, Centro de Histocompatibilidade do Norte, Rua Dr. Roberto Frias,
RL   Porto 4200-465, Portugal
XX
DR   MD5; e5e263cd52633b67d4b96ce2565c8bc9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2903
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2903
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2404variant"
FT   mRNA            join(<1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2899..>2903)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2404variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2899..2903)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2404variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C9EIW0"
FT                   /db_xref="IMGT/HLA:A*24:129"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C9EIW0"
FT                   /protein_id="ACV87225.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   gap             74..203
FT                   /estimated_length=130
FT   gap             474..714
FT                   /estimated_length=241
FT   gap             991..1569
FT                   /estimated_length=579
FT   gap             1846..1947
FT                   /estimated_length=102
FT   gap             2065..2506
FT                   /estimated_length=442
FT   gap             2540..2681
FT                   /estimated_length=142
FT   gap             2730..2898
FT                   /estimated_length=169
XX
SQ   Sequence 2903 BP; 222 A; 334 C; 362 G; 180 T; 1805 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cagnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttctcca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac       420
     tgaccgagcg aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccgnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngttctc       720
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg       900
     cggagcagca gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnna cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnagc catcttccca gcccaccgtc cccatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgctg      2040
     tgatgtggag gaggaacagc tcagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnatag aaaaggaggg      2520
     agctactctc aggctgcaan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2580
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngcagtgaca gtgcccaggg      2700
     ctctgatgtg tctctcacag cttgtaaagn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2760
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2820
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2880
     nnnnnnnnnn nnnnnnnntg tga                                              2903
//