spacer

EBI Dbfetch

ID   GQ850384; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   GQ850384;
XX
DT   04-OCT-2009 (Rel. 102, Created)
DT   04-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0202var allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-C*0202";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (28-AUG-2009) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstr. 10, Ulm, BW 89081,
RL   Germany
XX
DR   MD5; 5c0fe44a9ca65e7fe7e8fe07b0580f6e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0202var"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0202var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0202var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D0EL25"
FT                   /db_xref="IMGT/HLA:C*02:02:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D0EL25"
FT                   /protein_id="ACX29956.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0202var"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0202var"
FT                   /number=3
XX
SQ   Sequence 791 BP; 147 A; 259 C; 282 G; 103 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gaatattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctccgg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       480
     ctcgggggac gggctgacca cgggggcggg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac ctggggcccg acgggcgcct cctccgcggg tatgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacagc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer