spacer

EBI Dbfetch

ID   GQ452848; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   GQ452848;
XX
DT   15-SEP-2009 (Rel. 102, Created)
DT   15-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5801 new allele, exon
DE   4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Liu Y., Ji Y., Yang J., Du K.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Liu Y., Ji Y., Yang J., Du K.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   HLA Lab, Shanghai Blood Center, 1191 Hongqiao Road, Shanghai, Shanghai
RL   200051, China
XX
DR   MD5; d26162673710324121420175d2c4e73b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801 new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801 new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*58:01:04"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C9E311"
FT                   /protein_id="ACV60507.1"
FT                   /translation="PPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5801 new"
FT                   /number=4
FT   variation       239
FT                   /gene="HLA-B"
FT                   /replace="g"
XX
SQ   Sequence 276 BP; 68 A; 84 C; 82 G; 42 T; 0 other;
     accccccaaa gacacacgtg acccaccacc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacaac       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer