spacer

EBI Dbfetch

ID   GQ410120; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ410120;
XX
DT   09-SEP-2009 (Rel. 102, Created)
DT   09-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens isolate BY00501 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*040302 variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (23-JUL-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 73e2ea67bb3b9522ac4895e50d592ef8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00501"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040302 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040302 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040302 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C8CJD7"
FT                   /db_xref="IMGT/HLA:DRB1*04:04:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C8CJD7"
FT                   /protein_id="ACV31960.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040302 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 65 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer