Dbfetch

ID   GQ410118; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ410118;
XX
DT   09-SEP-2009 (Rel. 102, Created)
DT   09-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens isolate BY00499 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*010201 variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class II allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (23-JUL-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 0372919cd157dd96c2a25b898782ffc6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00499"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*010201 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*010201 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*010201 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C8CJD5"
FT                   /db_xref="IMGT/HLA:DRB1*01:23"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C8CJD5"
FT                   /protein_id="ACV31958.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*010201 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 63 C; 97 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//