Dbfetch

ID   GQ401340; SV 1; linear; genomic DNA; STD; HUM; 2677 BP.
XX
AC   GQ401340;
XX
DT   16-AUG-2009 (Rel. 101, Created)
DT   16-AUG-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2677
RA   Alves H., Tafulo S., Peixoto M., Vicario J.L., Balas A.;
RT   "Portuguese new HLA-B*40 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2677
RA   Alves H., Tafulo S., Peixoto M., Vicario J.L., Balas A.;
RT   ;
RL   Submitted (05-JUL-2009) to the INSDC.
RL   Direction, Centro de Histocompatibilidade do Norte, Rua Dr. Roberto Frias,
RL   Porto 4200-465, Portugal
XX
DR   MD5; e5b9a92eb5f043425b11525ace151198.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2677
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2677
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT   mRNA            join(<1..73,203..472,717..992,1568..1843,1937..2053,
FT                   2495..2527,2634..>2677)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,717..992,1568..1843,1937..2053,
FT                   2495..2527,2634..2677)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C7FNH8"
FT                   /db_xref="IMGT/HLA:B*40:124:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C7FNH8"
FT                   /protein_id="ACU31098.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=1
FT   gap             74..202
FT                   /estimated_length=129
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=2
FT   gap             473..716
FT                   /estimated_length=244
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=3
FT   variation       782
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   variation       784..785
FT                   /gene="HLA-B"
FT                   /replace="ta"
FT   variation       791
FT                   /gene="HLA-B"
FT                   /replace="t"
FT   gap             993..1567
FT                   /estimated_length=575
FT   exon            1568..1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=4
FT   gap             1844..1936
FT                   /estimated_length=93
FT   exon            1937..2053
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=5
FT   gap             2054..2494
FT                   /estimated_length=441
FT   exon            2495..2527
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=6
FT   gap             2528..2633
FT                   /estimated_length=106
FT   exon            2634..>2677
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=7
XX
SQ   Sequence 2677 BP; 220 A; 335 C; 360 G; 174 T; 1588 other;
     atgcgggtca cggcaccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nngctcccac tccatgaggt atttccacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       300
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cgnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc       720
     tcacaccctc cagaggatgt atggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gtaccaccag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat ctcccagcgc aagttggagg cggcccgtgt       900
     ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacaagc tggagcgcgc tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg tttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat gggnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct      1980
     ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg      2040
     aggaagagtt cagnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngtggaa aaggagggag ctactctcag      2520
     gctgcgtnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2580
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngcagcga      2640
     cagtgcccag ggctctgatg tgtctctcac agcttga                               2677
//